Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: ralso-PHBC

Ralstonia solanacearum (Pseudomonas solanacearum), Ralstonia pickettii (strains 12J; 12D), Ralstonia sp. Polyhydroxyalkanoic acid synthase (EC 2.3.1.-)

Comment
Other strains: Ralstonia solanacearum (Pseudomonas solanacearum)(strains GMI1000; UW551; MolK2; IPO1609; CFBP2957), Ralstonia pickettii (strains 12J; 12D), Ralstonia sp. 5_7_47FAA


Relationship
Family|PHA_synth_I
Block| X
Position in NCBI Life Tree|Ralstonia solanacearum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Burkholderiaceae: N E > Ralstonia: N E > Ralstonia solanacearum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





1 substrate:
3HB-CoA
No inhibitor
1 Genbank : AL646065
>3 UniProt links 2 more: A3RPI8, B2UFV0, Q8XYX5
>3 UniProt links 2 more: Q8XYX5, A3RPI8, B2UFV0
>3 Interpro links 2 more: Q8XYX5, A3RPI8, B2UFV0
>3 Prodom links 2 more: Q8XYX5, A3RPI8, B2UFV0
>3 Pfam links 2 more: Q8XYX5, A3RPI8, B2UFV0
>3 PIRSF links 2 more: Q8XYX5, A3RPI8, B2UFV0
>3 SUPERFAM links 2 more: Q8XYX5, A3RPI8, B2UFV0
Sequence
Graphical view for this peptide sequence: ralso-PHBC
Colored MSA for PHA_synth_I (raw)
MASRHKASSHATGSQAQPAWHGLADPAQWAEQFRQWQSMAGAFAQSGAPG
STGFGPAGGMPTGEGAMPFALIPPERLAEIQQKYLEAWLQIWGHMSAGDS
AETVAPSDRRFANDAWRKSPLYGYAAAFYVLNARTLMDMADAVQADAKTR
ERVRFAVSQWTAAMSPSNFLATNPEAQKQLIESRGESLRAGILNMLQDME
RGKISQTDETAFEIGRNVANSEGAVVFENDYFQLIQYKPLTAKVHARPLL
LVPPCINKYYILDLQPANSLVRYSVEQGHTVFLVSWRNPDASMAARNWDD
YIEGGAIEAIRVAREIAAQDRINVLGFCVGGTILSTALAVLAARGQHPAA
SLTLLTTLLDFSDTGILDVFVDQAQVEMREQTIGSAAPAGPGLLRGVELA
NTFSFLRPNDLVWNYVVENYLKGKTPAPFDLLYWNGDSTNLPGPWYCWYL
RHTYLQNDLMAPGRLTVCGEPVDLGRIEVPVYLYGSREDHIVPWKSAYAS
TQLLKGERRFVLGASGHIAGVINPPAANKRAHWINAGLPDSAQAWLDGAK
EHPGSWWPDWSAWLAKHAGAQKAAPKHYGNADHPVIEPAPGRYVKQKA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MASRHKASSHATGSQAQPAWHGLADPAQWAEQFRQWQSMAGAFAQSGAPG
STGFGPAGGMPTGEGAMPFALIPPERLAEIQQKYLEAWLQIWGHMSAGDS
AETVAPSDRRFANDAWRKSPLYGYAAAFYVLNARTLMDMADAVQADAKTR
ERVRFAVSQWTAAMSPSNFLATNPEAQKQLIESRGESLRAGILNMLQDME
RGKISQTDETAFEIGRNVANSEGAVVFENDYFQLIQYKPLTAKVHARPLL
LVPPCINKYYILDLQPANSLVRYSVEQGHTVFLVSWRNPDASMAARNWDD
YIEGGAIEAIRVAREIAAQDRINVLGFCVGGTILSTALAVLAARGQHPAA
SLTLLTTLLDFSDTGILDVFVDQAQVEMREQTIGSAAPAGPGLLRGVELA
NTFSFLRPNDLVWNYVVENYLKGKTPAPFDLLYWNGDSTNLPGPWYCWYL
RHTYLQNDLMAPGRLTVCGEPVDLGRIEVPVYLYGSREDHIVPWKSAYAS
TQLLKGERRFVLGASGHIAGVINPPAANKRAHWINAGLPDSAQAWLDGAK
EHPGSWWPDWSAWLAKHAGAQKAAPKHYGNADHPVIEPAPGRYVKQKA


References
1 more
    Title: Identification of open reading frames unique to a select agent: Ralstonia solanacearum race 3 biovar 2
    Gabriel DW, Allen C, Schell M, Denny TP, Greenberg JT, Duan YP, Flores-Cruz Z, Huang Q, Clifford JM and Mikhailova N <18 more author(s)>
    Ref: Mol Plant Microbe Interact, 19:69, 2006 : PubMed

            

    Title: Genome sequence of the plant pathogen Ralstonia solanacearum
    Salanoubat M, Genin S, Artiguenave F, Gouzy J, Mangenot S, Arlat M, Billault A, Brottier P, Camus JC and Boucher CA <18 more author(s)>
    Ref: Nature, 415:497, 2002 : PubMed

            

    Title: In vitro evolution of a polyhydroxybutyrate synthase by intragenic suppression-type mutagenesis
    Taguchi S, Nakamura H, Hiraishi T, Yamato I, Doi Y
    Ref: J Biochem, 131:801, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer