Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: rat-d3zbj1

Rattus norvegicus (Rat). Similar to novel protein similar to esterases

Relationship
Family|Arylacetamide_deacetylase
Block| H
Position in NCBI Life Tree|Rattus norvegicus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Rattus: N E > Rattus norvegicus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AABR07050377, XP_001074380, XP_345599.3
1 UniProt : D3ZBJ1
1 UniProt : D3ZBJ1
1 Interpro : D3ZBJ1
1 Pfam : D3ZBJ1
1 PIRSF : D3ZBJ1
1 SUPERFAM : D3ZBJ1
Sequence
Graphical view for this peptide sequence: rat-d3zbj1
Colored MSA for Arylacetamide_deacetylase (raw)
MAVLWLVLLGGMLTFFLGVFVWVFIQHLLTVEIPSTLKHPVKLRILHFSI
QYLITLGTILEKLRICSTPAFLLCVQDLIIIKKDPNMLVTDTRFGTVPVR
LFKPKKVSSKLRRGIIFYHGGGGIFGSLDVYHGLGNFLARETDSVVLLVG
YRKLPDHHHPVIHLDCLNASIHFLKNLQTYGVDPSRVVMAGESVGGWAVA
TVTQALACQDKLPQIRAQVLITPILQGVNFQLPSQLQKRNVPLLTRDLMI
TFFCRYLNIDLSWKNAILTGACVPPDMWKKYSKWLSSDNIPQRFKGKDFS
PEFLGPFNETAYLETKHVLDEKISPLLADDKIIAQLPDTFLLSCEHDILR
DDTLLYKKRLEDQGVPVTWHHVEDGFHGCIIFFDNQFFSFPCSMNALNPT
ISYIKGI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAVLWLVLLGGMLTFFLGVFVWVFIQHLLTVEIPSTLKHPVKLRILHFSI
QYLITLGTILEKLRICSTPAFLLCVQDLIIIKKDPNMLVTDTRFGTVPVR
LFKPKKVSSKLRRGIIFYHGGGGIFGSLDVYHGLGNFLARETDSVVLLVG
YRKLPDHHHPVIHLDCLNASIHFLKNLQTYGVDPSRVVMAGESVGGWAVA
TVTQALACQDKLPQIRAQVLITPILQGVNFQLPSQLQKRNVPLLTRDLMI
TFFCRYLNIDLSWKNAILTGACVPPDMWKKYSKWLSSDNIPQRFKGKDFS
PEFLGPFNETAYLETKHVLDEKISPLLADDKIIAQLPDTFLLSCEHDILR
DDTLLYKKRLEDQGVPVTWHHVEDGFHGCIIFFDNQFFSFPCSMNALNPT
ISYIKGI


Reference
    Title: Genome sequence of the Brown Norway rat yields insights into mammalian evolution
    Gibbs RA, Weinstock GM, Metzker ML, Muzny DM, Sodergren EJ, Scherer S, Scott G, Steffen D, Worley KC and Collins F <218 more author(s)>
    Ref: Nature, 428:493, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer