ratno-3plip

 
Rattus norvegicus (Rat) Pancreatic lipase-related protein 1 precursor (EC 3.1.1.3)

Relationship
Block L
Rattus norvegicus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Rattus: N E > Rattus norvegicus: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



3 Genbank : X61925, AABR07007081, CH473986
2 UniProt : P54316, G3V8A9
1 Ncbi-nid : 56599
2 UniProtTrembl : P54316, G3V8A9
2 Interpro : P54316, G3V8A9
2 Prodom : P54316, G3V8A9
2 Pfam : P54316, G3V8A9
2 PIRSF : P54316, G3V8A9
2 SUPERFAM : P54316, G3V8A9
2 QuickSwissBlast : P54316, G3V8A9
 
Sequence
Graphical view for this peptide sequence: ratno-3plip
Colored MSA for Pancreatic_lipase (raw)
MLTLWTVSLFLLGAAQGKEVCYDNLGCFSDAEPWAGTAIRPLKLLPWSPE
KINTRFLLYTNENPTAFQTLQLSDPLTIGASNFQVARKTRFIIHGFIDKG
EENWVVDMCKNMFQVEEVNCICVDWKKGSQTTYTQAANNVRVVGAQVAQM
IDILVKNYSYSPSKVHLIGHSLGAHVAGEAGSRTPGLGRITGLDPVEANF
EGTPEEVRLDPSDADFVDVIHTDAAPLIPFLGFGTNQMSGHLDFFPNGGQ
SMPGCKKNALSQIVDIDGIWSGTRDFVACNHLRSYKYYLESILNPDGFAA
YPCASYKDFESNKCFPCPDQGCPQMGHYADKFAGKSGDEPQKFFLNTGEA
KNFARWRYRVSLILSGRMVTGQVKVALFGSKGNTRQYDIFRGIIKPGATH
SSEFDAKLDVGTIEKVKFLWNNQVINPSFPKVGAAKITVQKGEERTEYNF
CSEETVREDTLLTLLPCETSDTV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLTLWTVSLFLLGAAQGKEVCYDNLGCFSDAEPWAGTAIRPLKLLPWSPE
KINTRFLLYTNENPTAFQTLQLSDPLTIGASNFQVARKTRFIIHGFIDKG
EENWVVDMCKNMFQVEEVNCICVDWKKGSQTTYTQAANNVRVVGAQVAQM
IDILVKNYSYSPSKVHLIGHSLGAHVAGEAGSRTPGLGRITGLDPVEANF
EGTPEEVRLDPSDADFVDVIHTDAAPLIPFLGFGTNQMSGHLDFFPNGGQ
SMPGCKKNALSQIVDIDGIWSGTRDFVACNHLRSYKYYLESILNPDGFAA
YPCASYKDFESNKCFPCPDQGCPQMGHYADKFAGKSGDEPQKFFLNTGEA
KNFARWRYRVSLILSGRMVTGQVKVALFGSKGNTRQYDIFRGIIKPGATH
SSEFDAKLDVGTIEKVKFLWNNQVINPSFPKVGAAKITVQKGEERTEYNF
CSEETVREDTLLTLLPCETSDTV

Graphical view for this nucleotide DNA sequence (1578 bp): ratno-3plip



References
1 more
    Title: Genome sequence of the Brown Norway rat yields insights into mammalian evolution
    Gibbs RA, Weinstock GM, Metzker ML, Muzny DM, Sodergren EJ, Scherer S, Scott G, Steffen D, Worley KC and Collins F <218 more author(s)>
    Ref: Nature, 428:493, 2004 : PubMed

            

    Title: Pancreatic lipase-related protein 1 (PLRP1) is present in the pancreatic juice of several species
    De Caro J, Carriere F, Barboni P, Giller T, Verger R, de Caro A
    Ref: Biochimica & Biophysica Acta, 1387:331, 1998 : PubMed

            

    Title: Primary structure of rat pancreatic lipase mRNA
    Wicker-Planquart C, Puigserver A
    Ref: FEBS Letters, 296:61, 1992 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer