ratno-P97535
Rattus norvegicus (Rat) ps-pla1 precursor
Relationship
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain. > cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Rattus: N E > Rattus norvegicus: N E
A85-EsteraseD-FGH :
rat-estd Rattus norvegicus (Rat) Esterase D .
ABHD6-Lip :
rat-abhd6 Rattus norvegicus (Rat) Abhydrolase domain-containing protein 6 .
ABHD8 :
rat-b5den3 Rattus norvegicus (Rat). Abhydrolase domain-containing 8 .
ABHD10 :
rat-abhda Rattus norvegicus (Rat) Abhydrolase domain-containing protein 10, mitochondrial .
ABHD11-Acetyl_transferase :
rat-d3zxk4 Rattus norvegicus (Rat). Abhydrolase domain-containing 11 .
ABHD12-PHARC :
ratno-q6ayt7 Rattus norvegicus (Rat) hypothetical protein .
ABHD13-BEM46 :
rat-d4a1b6 Rattus norvegicus (Rat). Similar to 1110065L07Rik protein (Predicted), isoform CRA_b .
ABHD16 :
ratno-q5xil6 Rattus norvegicus (Rat) rgd1309726_predicted protein ,
ratno-q6mg55 Rattus norvegicus (Rat) hla-b associated transcript 5, rat orthologue .
ABHD17-depalmitoylase :
ratno-q5xij5 Rattus norvegicus (Rat) similar to cdna sequence bc005632 AB17A ,
ratno-q6ay17 Rattus norvegicus (Rat) AB17B hypothetical protein ,
rat-ab17c Rattus norvegicus (Rat). Alpha/beta hydrolase domain-containing protein 17C .
ABHD18 :
rat-cd029 Rattus norvegicus (Rat) Uncharacterized protein ABHD18 C4orf29 homolog .
abh_upf0017 :
rat-d4a7w1 Rattus norvegicus (Rat) Protein Abhd2 ,
ratno-ABH15 Rattus norvegicus (Rat) Abhydrolase domain-containing 15 ,
ratno-abhd1 Rattus norvegicus (Rat) abhydrolase domain containing 1 (predicted) ,
ratno-d4a3d4 Rattus norvegicus (Rat) lung alpha/beta hydrolase fold protein 3 .
ACHE :
ratno-ACHE Rattus norvegicus (Rat) Acetylcholinesterase .
Acidic_Lipase :
rat-d3zuq1 Rattus norvegicus (Rat) Lipase ,
rat-d4a9l7 Rattus norvegicus (Rat) Lipase ,
rat-d4aa33 Rattus norvegicus (Rat) Lipase ,
rat-d4aa61 Rattus norvegicus (Rat) Lipase ,
ratno-1lipg Rattus norvegicus (Rat) Lingual lipase ,
ratno-1llip Rattus norvegicus (Rat) lysosomal acid lipase, intracellular hydrolase rats, Wolman, liver mRNA .
ACPH_Peptidase_S9 :
ratno-acph Rattus norvegicus (Rat) Acyl-peptide hydrolase; Acylamino-acid-releasing enzyme .
Acyl-CoA_Thioesterase :
ratno-acot1 Rattus norvegicus (Rat) hydrolase) (cte-I) (lach2) (ach2) ,
ratno-acot2 Rattus norvegicus (Rat) (EC 3.1.2.2) ACOT2 mitochondrial Acyl-CoA thioesterase 1 very-long-chain Acyl-CoA thioesterase (MTE-I) ,
ratno-BAAT Rattus norvegicus (Rat) bile acid CoA: amino acid n-acyltransferase kan-1 (EC 3.1.2.2) ,
ratno-q5fvr5 Rattus norvegicus (Rat) hypothetical loc313220 .
Arylacetamide_deacetylase :
rat-nceh1 Rattus norvegicus (Rat) Arylacetamide deacetylase-like 1 ,
ratno-aryla Rattus norvegicus (Rat) Arylacetamide deacetylase gene (aadac) ,
rat-d3zba8 Rattus norvegicus (Rat). Similar to arylacetamide deacetylase (Predicted) ,
rat-d3zbj1 Rattus norvegicus (Rat). Similar to novel protein similar to esterases ,
rat-d3zcr8 Rattus norvegicus (Rat). Arylacetamide deacetylase-like 3 ,
rat-d3zxw5 Rattus norvegicus (Rat). Similar to hypothetical protein C130079G13 ,
rat-d4a340 Rattus norvegicus (Rat). Similar to arylacetamide deacetylase ,
rat-f1lvg7 Rattus norvegicus (Rat). Similar to hypothetical protein C130079G13 ,
rat-m0r509 Rattus norvegicus (Rat). Similar to hypothetical protein C130079G13 ,
rat-m0r5d4 Rattus norvegicus (Rat). Arylacetamide deacetylase-like 2 .
BCHE :
ratno-BCHE Rattus norvegicus (Rat) Butyrylcholinesterase .
Carboxypeptidase_S10 :
ratno-CPVL Rattus norvegicus (Rat) hypothetical protein loc502774 ,
ratno-Ppgb Rattus norvegicus (Rat) Lysosomal protective protein, Cathepsin A Ctsa, Protective protein for beta-galactosidase Ppgb ,
ratno-RISC Rattus norvegicus (Rat) retinoid-inducible serine carboxypeptidase precursor .
Carb_B_Chordata :
ratno-cauxin Rattus norvegicus (Rat) Carboxylesterase 5A (old est7) Epididymis-specific carboxylesterase 615 protein Carboxylesterase-like urinary excreted protein homolog ,
ratno-Ces1c Rattus norvegicus (Rat) Neutral retinyl ester hydrolase ,
ratno-Ces1d Rattus norvegicus (Rat) Carboxylesterase (ES-HVEL) pI 6.1 esterase (ES-10) CES1D Ces1d ,
ratno-Ces1e Rattus norvegicus (Rat) Liver carboxylesterase Carboxylesterase 1E ES-3 (egasyn) ,
ratno-Ces2f Rattus norvegicus (Rat) Protein Ces2f ,
ratno-CESRRL1 Rattus norvegicus (Rat) carboxylesterase rl1 ,
ratno-d3ze31 Rattus norvegicus (Rat) Putative uncharacterized protein RGD1565045 ,
ratno-d3zp14 Rattus norvegicus (Rat) Putative uncharacterized protein LOC685645 ,
ratno-d3zxq0 Rattus norvegicus (Rat) Similar to 2210023G05Rik protein (Predicted) ,
ratno-d3zxq1 Rattus norvegicus (Rat) Putative uncharacterized protein ENSRNOP00000044470 ,
ratno-d4aa05 Rattus norvegicus (Rat) Putative uncharacterized protein LOC679817 ,
ratno-est8 Rattus norvegicus (Rat) RCG51618 ,
ratno-kmcxe Rattus norvegicus (Rat) Liver carboxylesterase 4, kydney microsomal carboxylesterase Liver carboxylesterase 4 ES-4 ,
ratno-lmcxe Rattus norvegicus (Rat) Liver microsomal carboxylesterase Ces1f ,
ratno-LOC246252 Rattus norvegicus carboxylesterase isoenzyme gene (LOC246252) Ces1h EST2A Ces2a ,
ratno-pbcxe Rattus norvegicus (Rat) Phenobarbital-inducible carboxylesterase precursor ,
ratno-phebest Rattus norvegicus (Rat) Carboxylesterase, partial cds ,
ratno-q4qr68 Rattus norvegicus (Rat) hypothetical protein Ces2b ,
ratno-q32q55 Rattus norvegicus (Rat) hypothetical protein ,
ratno-q68g49 Rattus norvegicus (Rat) loc291863 protein ,
ratno-sicxe Rattus norvegicus (Rat) small intestinal carboxylesterase precursor ,
rat-a0a0g2k9y7 Rattus norvegicus (Rat). Carboxylic ester hydrolase ,
rat-a0a0g2kb83 Rattus norvegicus (Rat). Carboxylic ester hydrolase .
CGI-58_ABHD5_ABHD4 :
rat-d3zaw4 Rattus norvegicus (Rat) Uncharacterized protein ,
ratno-abhd5 Rattus norvegicus (Rat) cgi-58-like protein .
Cholesterol_esterase :
ratno-balip Rattus norvegicus (Rat) Cholesterol esterase .
CIB-CCG1-interacting-factor-B :
rat-abhea Rattus norvegicus (Rat) Abhydrolase domain-containing protein 14A ,
rat-abheb Rattus norvegicus (Rat) Abhydrolase domain-containing protein 14B .
CMBL :
ratno-CMBL Rattus norvegicus (Rat) ab2-225 (2310016a09rik protein) .
DPP4N_Peptidase_S9 :
rat-dpp9 Rattus norvegicus (Rat) Dipeptidyl peptidase 9 DPP9,
rat-d3zhq1 Rattus norvegicus (Rat) DPP8 ,
ratno-dpp4 Rattus norvegicus (Rat) Dipeptidyl peptidase IV (DPP),
ratno-dpp6 Rattus norvegicus (Rat) Dipeptidyl aminopeptidase-like protein 6 (dipeptidylpeptidase VI) (dppx) ,
ratno-FAP Rattus norvegicus (Rat) fibroblast activation protein alpha subunit ,
ratno-q6q629 Rattus norvegicus (Rat) DPP-10 Dipeptidyl peptidase IV-related , kv4 potassium channel auxiliary subunit .
Duf_676 :
rat-d3zxw8 Rattus norvegicus (Rat) Protein Fam135a Similar to KIAA1411 protein ,
rat-f1lz91 Rattus norvegicus (Rat) Protein RGD1308133 .
Duf_726 :
rat-tmco4 Rattus norvegicus (Rat) Transmembrane and coiled-coil domain-containing protein 4 .
Epoxide_hydrolase :
rat-d3zkp8 Rattus norvegicus (Rat) Uncharacterized protein ,
rat-d4a4w4 Rattus norvegicus (Rat) Uncharacterized protein ,
ratno-hyep Rattus norvegicus (Rat) Epoxide hydrolase 1, Epoxide hydratase ,
ratno-hyes Rattus norvegicus (Rat) Bifunctional epoxide hydrolase 2, cytosolic epoxide hydrolase, Lipid-phosphate phosphatase .
Hepatic_Lipase :
ratno-1hlip Rattus norvegicus (Rat) Triacylglycerol lipase hepatic .
Hormone-sensitive_lipase_like :
ratno-hslip Rattus norvegicus (Rat) Hormone sensitive lipase .
Hydrolase_RBBP9_YdeN :
ratno-rbbp9 Rattus norvegicus (Rat) Retinoblastoma-binding protein 9 B5T overexpressed gene protein (bog protein) .
Kynurenine-formamidase :
rat-m0rc77 Rattus norvegicus (Rat). N-formylkynurenine formamidase .
LIDHydrolase :
rat-Ldah Rattus norvegicus (Rat) UPF0554 protein LDAH C2orf43 homolog .
Lipase_3 :
rat-dglb Rattus norvegicus (Rat) Sn1-specific diacylglycerol lipase beta ,
ratno-q5ylm1 Rattus norvegicus (Rat) neural stem cell-derived dendrite regulator .
Lipoprotein_Lipase :
ratno-lipli Rattus norvegicus (Rat) Lipoprotein lipase ,
ratno-q5d216 Rattus norvegicus (Rat) endothelial lipase Lipg .
LYsophospholipase_carboxylesterase :
ratno-lypla1a Rattus norvegicus (Rat) Lysophospholipase (Pla1a) ,
ratno-lypla2 Rattus norvegicus (Rat) Lysophospholipase II .
Maspardin-ACP33-SPG21_like :
ratno-SPG21 Rattus norvegicus (Rat) acid cluster protein 33 (Spg21) Maspardin .
MEST-like :
ratno-q6p5p5 Rattus norvegicus (Rat) Mesoderm-specific transcript homolog protein .
Monoglyceridelipase_lysophospholip :
ratno-MGLL Rattus norvegicus (rat) monoglyceride lipase (Mgl2) .
Ndr_family :
ratno-ndr4 Rattus norvegicus (Rat) ndrg4 protein (brain development-related molecule 1) ndrg4-b1 ndrg4-a2 ,
ratno-NDRG2 Rattus norvegicus (Rat) ndrg1 related protein ndrg2b1 (ndrg1 related protein ndrg2a1) ,
ratno-q6ayr2 Rattus norvegicus (Rat) hypothetical protein ,
ratno-q6je36 Rattus norvegicus (Rat) n-myc downstream regulated 1 (hypothetical protein) .
Neuroligin :
ratno-1neur Rattus norvegicus (Rat) Neuroligin 1,
ratno-2neur Rattus norvegicus (Rat) Neuroligin 2,
ratno-3neur Rattus norvegicus (Rat) Neuroligin 3 Nlgn3 .
NLS3-Tex30 :
rat-Kansl3 Rattus norvegicus (Rat) Non-specific lethal 3 homologue Uncharacterized protein KIAA1310 homolog ,
rat-Tex30 Rattus norvegicus (Rat) Putative uncharacterized protein RGD1309095_predicted .
PAF-Acetylhydrolase :
ratno-paf2 Rattus norvegicus (Rat) PAFAHII platelet-activating factor acetylhydrolase II ,
ratno-q5m7t7 Rattus norvegicus (Rat) acetylhydrolase, plasma) (predicted) .
Palmitoyl-protein_thioesterase :
ratno-ppt Rattus norvegicus (Rat) Palmitoyl-protein thioesterase 1 ,
ratno-PPT2 Rattus norvegicus (Rat) palmitoyl-protein thioesterase 2, EC 3.1.2.22 .
Pancreatic_lipase :
ratno-1plip Rattus norvegicus (Rat) Pancreatic lipase ,
ratno-3plip Rattus norvegicus (Rat) Pancreatic lipase-related protein 1 precursor (EC 3.1.1.3) ,
ratno-4plip Rattus norvegicus mRNA for glycosylated membrane-associated lipase.
PC-sterol_acyltransferase :
ratno-lcat Rattus norvegicus (Rat) Phosphatidylcholine-sterol acyltransfer ,
ratno-q675a5 Rattus norvegicus (Rat) lysosomal phospholipase a2 .
Pectinacetylesterase-Notum :
ratno-d3zxi3 Rattus norvegicus (Rat) Notum .
PGAP1 :
ratno-q765a7 Rattus norvegicus (Rat) gpi deacylase .
Phospholipase :
ratno-q6p6s8 Rattus norvegicus (Rat) hypothetical protein (fragment) ,
rat-d3zmg4 Rattus norvegicus (Rat). Lipase, member H (Predicted) .
Prolylcarboxypeptidase :
rat-d4aa31 Rattus norvegicus (Rat) Protein Prcp ,
ratno-dpp2 Rattus norvegicus (Rat) Dipeptidyl aminopeptidase II (quiescent cell proline dipeptidase) ,
ratno-q3mhs0 Rattus norvegicus (Rat) protease, serine, 16 (thymus) .
S9N_PPCE_Peptidase_S9 :
ratno-RPOP Rattus norvegicus (Rat) Prolyl endopeptidase rPop .
S9N_PREPL_Peptidase_S9 :
ratno-q5hza6 Rattus norvegicus (Rat) similar to riken cdna d030028o16 (predicted) .
SERHL :
rat-d4a071 Rattus norvegicus (Rat) Similar to serine hydolase like protein, isoforms Serhl-2 (Predicted) .
Thioesterase :
ratno-fas Rattus norvegicus (Rat) fatty acid synthase FAS Thioesterase domain ,
ratno-sast Rattus norvegicus (Rat) (thioesterase II) .
Thyroglobulin :
ratno-thyro Rattus norvegicus (Rat) Thyroglobulin .
Valacyclovir-hydrolase :
ratno-q3b8n9 Rattus norvegicus (Rat) biphenyl hydrolase-like , breast epithelial mucin-assoc AG BPHL Molecular evidence
Database
No mutation No structure No kinetic
Sequence
Graphical view for this peptide sequence: ratno-P97535 Colored MSA for Phospholipase (raw)
MCPGLWGTCFWLWGSLLWLSIGRSGNVPPTTQPKCTDFQSANLLRGTNLK
VQFLLFTPSDPGCGQLVEEDSDIRNSEFNASLGTKLIIHGFRALGTKPSW
INKFIRALLRAADANVIAVDWVYGSTGMYFSAVENVVKLSLEISRFLSKL
LELGVSESSIHIIGVSLGAHVGGMVGHFYKGQLGRITGLDPAGPEYTRAS
LEERLDSGDALFVEAIHTDTDNLGIRIPVGHVDYFVNGGQDQPGCPAFIH
AGYSYLICDHMRAVHLYISALENTCPLMAFPCASYKAFLAGDCLDCFNPF
LLSCPRIGLVERGGVKIEPLPKEVRVYLQTTSSAPYCVHHSLVEFNLKEK
RKKDTSIEVTFLGNNVTSSVKITIPKDHLEGRGIIAHQNPHCQINQVKLK
FHISSRVWRKDRTPIVGTFCTAPLPVNDSKKTVCIPEPVRLQVSMAVLRD
LKMACV
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
M C P G L W G T C F W L W G S L L W L S I G R S G N V P P T T Q P K C T D F Q S A N L L R G T N L K V Q F L L F T P S D P G C G Q L V E E D S D I R N S E F N A S L G T K L I I H G F R A L G T K P S W I N K F I R A L L R A A D A N V I A V D W V Y G S T G M Y F S A V E N V V K L S L E I S R F L S K L L E L G V S E S S I H I I G V S L G A H V G G M V G H F Y K G Q L G R I T G L D P A G P E Y T R A S L E E R L D S G D A L F V E A I H T D T D N L G I R I P V G H V D Y F V N G G Q D Q P G C P A F I H A G Y S Y L I C D H M R A V H L Y I S A L E N T C P L M A F P C A S Y K A F L A G D C L D C F N P F L L S C P R I G L V E R G G V K I E P L P K E V R V Y L Q T T S S A P Y C V H H S L V E F N L K E K R K K D T S I E V T F L G N N V T S S V K I T I P K D H L E G R G I I A H Q N P H C Q I N Q V K L K F H I S S R V W R K D R T P I V G T F C T A P L P V N D S K K T V C I P E P V R L Q V S M A V L R D L K M A C V no DNA
Reference
Title: Serine phospholipid-specific phospholipase A that is secreted from activated platelets. A new member of the lipase family
Sato T , Aoki J , Nagai Y , Dohmae N , Takio K , Doi T , Arai H , Inoue K
Ref: Journal of Biological Chemistry, 272 :2192, 1997 : PubMed Abstract ESTHER: Sato_1997_J.Biol.Chem_272_2192 PubMedSearch: Sato 1997 J.Biol.Chem 272 2192 PubMedID: 8999922 Gene_locus related to this paper: human-PLA1A ,
ratno-P97535 Abstract
Rat platelets secrete two types of phospholipases upon stimulation; one is type II phospholipase A2 and the other is serine-phospholipid-selective phospholipase A. In the current study we purified serine-phospholipid-selective phospholipase A and cloned its cDNA. The final preparation, purified from extracellular medium of activated rat platelets, gave a 55-kDa protein band on SDS-polyacrylamide gel electrophoresis. [3H]Diisopropyl fluorophosphate, an inhibitor of the enzyme, labeled the 55-kDa protein, suggesting that this polypeptide possesses active serine residues. The cDNA for the enzyme was cloned from a rat megakaryocyte cDNA library. The predicted 456-amino acid sequence contains a putative short N-terminal signal sequence and a GXSXG sequence, which is a motif of an active serine residue of serine esterase. Amino acid sequence homology analysis revealed that the enzyme shares about 30% homology with mammalian lipases (lipoprotein lipase, hepatic lipase, and pancreatic lipase). Regions surrounding the putative active serine, histidine, and aspartic acid, which may form a "lipase triad," were highly conserved among these enzymes. The recombinant protein, which we expressed in Sf9 insect cells using the baculovirus system, hydrolyzed a fatty acyl residue at the sn-1 position of lysophosphatidylserine and phosphatidylserine, but did not appreciably hydrolyze phosphatidylcholine, phosphatidylethanolamine, phosphatidylinositol, phosphatidic acid, and triglyceride. The present enzyme, named phosphatidylserine-phospholipase A1, is the first phospholipase that exclusively hydrolyses the sn-1 position and has a strict head group specificity for the substrate.
         Other Papers