ratno-P97535

 
Rattus norvegicus (Rat) ps-pla1 precursor

Relationship
Block L
Rattus norvegicus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Rattus: N E > Rattus norvegicus: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



1 Genbank : D88666
1 UniProtTrembl : P97535
1 Interpro : P97535
1 Prodom : P97535
1 Pfam : P97535
1 PIRSF : P97535
1 SUPERFAM : P97535
1 QuickSwissBlast : P97535
 
Sequence
Graphical view for this peptide sequence: ratno-P97535
Colored MSA for Phospholipase (raw)
MCPGLWGTCFWLWGSLLWLSIGRSGNVPPTTQPKCTDFQSANLLRGTNLK
VQFLLFTPSDPGCGQLVEEDSDIRNSEFNASLGTKLIIHGFRALGTKPSW
INKFIRALLRAADANVIAVDWVYGSTGMYFSAVENVVKLSLEISRFLSKL
LELGVSESSIHIIGVSLGAHVGGMVGHFYKGQLGRITGLDPAGPEYTRAS
LEERLDSGDALFVEAIHTDTDNLGIRIPVGHVDYFVNGGQDQPGCPAFIH
AGYSYLICDHMRAVHLYISALENTCPLMAFPCASYKAFLAGDCLDCFNPF
LLSCPRIGLVERGGVKIEPLPKEVRVYLQTTSSAPYCVHHSLVEFNLKEK
RKKDTSIEVTFLGNNVTSSVKITIPKDHLEGRGIIAHQNPHCQINQVKLK
FHISSRVWRKDRTPIVGTFCTAPLPVNDSKKTVCIPEPVRLQVSMAVLRD
LKMACV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MCPGLWGTCFWLWGSLLWLSIGRSGNVPPTTQPKCTDFQSANLLRGTNLK
VQFLLFTPSDPGCGQLVEEDSDIRNSEFNASLGTKLIIHGFRALGTKPSW
INKFIRALLRAADANVIAVDWVYGSTGMYFSAVENVVKLSLEISRFLSKL
LELGVSESSIHIIGVSLGAHVGGMVGHFYKGQLGRITGLDPAGPEYTRAS
LEERLDSGDALFVEAIHTDTDNLGIRIPVGHVDYFVNGGQDQPGCPAFIH
AGYSYLICDHMRAVHLYISALENTCPLMAFPCASYKAFLAGDCLDCFNPF
LLSCPRIGLVERGGVKIEPLPKEVRVYLQTTSSAPYCVHHSLVEFNLKEK
RKKDTSIEVTFLGNNVTSSVKITIPKDHLEGRGIIAHQNPHCQINQVKLK
FHISSRVWRKDRTPIVGTFCTAPLPVNDSKKTVCIPEPVRLQVSMAVLRD
LKMACV

no DNA




Reference
    Title: Serine phospholipid-specific phospholipase A that is secreted from activated platelets. A new member of the lipase family
    Sato T, Aoki J, Nagai Y, Dohmae N, Takio K, Doi T, Arai H, Inoue K
    Ref: Journal of Biological Chemistry, 272:2192, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer