Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: ratno-kmcxe

Rattus norvegicus (Rat) Liver carboxylesterase 4, kydney microsomal carboxylesterase Liver carboxylesterase 4 ES-4

Relationship
Family|Carb_B_Chordata
Block| C
Position in NCBI Life Tree|Rattus norvegicus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Rattus: N E > Rattus norvegicus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : U10697, X81825, BC128711
2 UniProt : Q64573, F1LLV6
2 Ncbi-pid : 562008, 550418
2 UniProt : Q64573, F1LLV6
2 Interpro : Q64573, F1LLV6
2 Pfam : Q64573, F1LLV6
2 PIRSF : Q64573, F1LLV6
2 SUPERFAM : Q64573, F1LLV6
Sequence
Graphical view for this peptide sequence: ratno-kmcxe
Colored MSA for Carb_B_Chordata (raw)
MCLSFLFLVSLATCVVYGNPSSPPVVDTTKGKVLGKYVSLEGVTQSVAVF
LGVPFAKPPPGSLRFAPPQPAEPWSFVKNTTTYPPMCSQDAAKGQRMNDL
LTNRKEKIHLEFSEDCLYLNIYTPADFTKNSRLPVMVWIHGGGMTLGGAS
TYDGRVLSAYENVVVVAIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALHW
VQDNIANFGGDPASVTIFGESAGGFSVSVLVLSPLTKNLFHRAISESGVV
FLTGLLTKDVRPAAKQIADMAGCETTTSAIIVHCLRQKTEEELLEIMKKM
NLIKLSSQRITKESYHFLSTVVDNVVLPKDPKEILAEKNFNNVPYIVGIN
KQECGWLLPTMMGFVPADVELDKKMAITLLEKFASLYGIPEDIIPVAIEK
YRKGSDDSIKIRDGILAFIGDVSFFYPSVMVSRDHRDAGAPTYMYEYQYY
PSFSSPQRPKHVVGDHADDLYSVFGAPILRDGASEEEIKLSKMVMKFWAN
FARNGNPNARGLPHWPQYDQKEEYLQIGATTQQSQRLKAEEVAFWTQLLA
KREPQPHHNEL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MCLSFLFLVSLATCVVYGNPSSPPVVDTTKGKVLGKYVSLEGVTQSVAVF
LGVPFAKPPPGSLRFAPPQPAEPWSFVKNTTTYPPMCSQDAAKGQRMNDL
LTNRKEKIHLEFSEDCLYLNIYTPADFTKNSRLPVMVWIHGGGMTLGGAS
TYDGRVLSAYENVVVVAIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALHW
VQDNIANFGGDPASVTIFGESAGGFSVSVLVLSPLTKNLFHRAISESGVV
FLTGLLTKDVRPAAKQIADMAGCETTTSAIIVHCLRQKTEEELLEIMKKM
NLIKLSSQRITKESYHFLSTVVDNVVLPKDPKEILAEKNFNNVPYIVGIN
KQECGWLLPTMMGFVPADVELDKKMAITLLEKFASLYGIPEDIIPVAIEK
YRKGSDDSIKIRDGILAFIGDVSFFYPSVMVSRDHRDAGAPTYMYEYQYY
PSFSSPQRPKHVVGDHADDLYSVFGAPILRDGASEEEIKLSKMVMKFWAN
FARNGNPNARGLPHWPQYDQKEEYLQIGATTQQSQRLKAEEVAFWTQLLA
KREPQPHHNEL


References
1 more
    Title: Cloning and sequencing of rat liver carboxylesterase ES-4 (microsomal palmitoyl-CoA hydrolase).
    Robbi M, van Schaftingen E, Beaufay H
    Ref: Biochemical Journal, 313:821, 1996 : PubMed

            

    Title: Purification and characterization of two rat liver microsomal carboxylesterases (hydrolase A and B)
    Morgan EW, Yan B, Greenway D, Petersen DR, Parkinson A
    Ref: Archives of Biochemistry & Biophysics, 315:495, 1994 : PubMed

            

    Title: Rat kidney carboxylesterase. Cloning, sequencing, cellular localization, and relationship to rat liver hydrolase
    Yan B, Yang D, Brady M, Parkinson A
    Ref: Journal of Biological Chemistry, 269:29688, 1994 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer