Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: ratno-lmcxe

Rattus norvegicus (Rat) Liver microsomal carboxylesterase Ces1f

Relationship
Family|Carb_B_Chordata
Block| C
Position in NCBI Life Tree|Rattus norvegicus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Rattus: N E > Rattus norvegicus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 2 more: U10698, BC079129, AABR06097318
2 UniProt : Q63010, M0R7R1
1 Ncbi-nid : 562009
1 Ncbi-pid : 562010
2 UniProt : Q63010, M0R7R1
2 Interpro : Q63010, M0R7R1
2 Pfam : Q63010, M0R7R1
2 PIRSF : Q63010, M0R7R1
2 SUPERFAM : Q63010, M0R7R1
Sequence
Graphical view for this peptide sequence: ratno-lmcxe
Colored MSA for Carb_B_Chordata (raw)
MCLRSLFLVSLATCVVCGNPSSPPVVDTMKGKVLGKYASLEGVTQSVAVF
LGVPFAKPPLGSLRFAPPQPAEPWSFVKNTTTYPPMCSQDATKGQRMNDL
LTNRKEKVHLQFSEDCLYLNIYTPADFTKDSRMPVMVWIHGGGLTQGGAS
TYDGQVLSAYENVVVVAIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALHW
VQDNIANFGGDPGSVTIFGESAGGFSVSVLVLSPLSKNLYHRAISESGVV
LITELFTKDVRPAAKQIADMAGCKTTTSAIIVHCLRQKTEEELLEIMEKM
NLIKLSSQRDTKESYHFLSTVIDDVVLPKDPKEILAEKNFNTVPYIVGIN
KQECGWLLPTMMRFVPPDVKLDKKMAIMLLEKFASIYGIPEDIIPVAIEK
YRKGSDDPIKIRDGILAFIGDVLFCIPSVMVSRDHRDAGAPTYVYEYQYY
PSFSSPQRPKDVVGDHADDVYSVFGAPILRDGASEEEIKLSKMVMKFWAN
FARNGNPNARGLPHWPQYDQKEEYLQIGATTQQSQRLKAEEVAFWTQLLA
KRQPQPHHNEL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MCLRSLFLVSLATCVVCGNPSSPPVVDTMKGKVLGKYASLEGVTQSVAVF
LGVPFAKPPLGSLRFAPPQPAEPWSFVKNTTTYPPMCSQDATKGQRMNDL
LTNRKEKVHLQFSEDCLYLNIYTPADFTKDSRMPVMVWIHGGGLTQGGAS
TYDGQVLSAYENVVVVAIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALHW
VQDNIANFGGDPGSVTIFGESAGGFSVSVLVLSPLSKNLYHRAISESGVV
LITELFTKDVRPAAKQIADMAGCKTTTSAIIVHCLRQKTEEELLEIMEKM
NLIKLSSQRDTKESYHFLSTVIDDVVLPKDPKEILAEKNFNTVPYIVGIN
KQECGWLLPTMMRFVPPDVKLDKKMAIMLLEKFASIYGIPEDIIPVAIEK
YRKGSDDPIKIRDGILAFIGDVLFCIPSVMVSRDHRDAGAPTYVYEYQYY
PSFSSPQRPKDVVGDHADDVYSVFGAPILRDGASEEEIKLSKMVMKFWAN
FARNGNPNARGLPHWPQYDQKEEYLQIGATTQQSQRLKAEEVAFWTQLLA
KRQPQPHHNEL


References
1 more
    Title: Molecular aspects of carboxylesterase isoforms in comparison with other esterases
    Satoh T, Hosokawa M
    Ref: Toxicol Lett, 82-83:439, 1995 : PubMed

            

    Title: Cloning and expression of hydrolase C, a member of the rat carboxylesterase family
    Yan B, Yang D, Parkinson A
    Ref: Archives of Biochemistry & Biophysics, 317:222, 1995 : PubMed

            

    Title: Rat kidney carboxylesterase. Cloning, sequencing, cellular localization, and relationship to rat liver hydrolase
    Yan B, Yang D, Brady M, Parkinson A
    Ref: Journal of Biological Chemistry, 269:29688, 1994 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer