Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: ratno-ndr4

Rattus norvegicus (Rat) ndrg4 protein (brain development-related molecule 1) ndrg4-b1 ndrg4-a2

Comment
ratno-ndr4 (Bdm1) is associated with hot water epilepsy (Bhaduri et al. 2003) Mutations in another gene of the family (human-NDRG1) are responsible for Hereditary motor and sensory neuropathy, LOM Type Kalaydjieva_2000_Am.J.Hum.Genet_67_47


Relationship
Family|Ndr_family
Block| X
Position in NCBI Life Tree|Rattus norvegicus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Rattus: N E > Rattus norvegicus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 5 more: AY217032, AY217030, AY217033
>3 UniProt links 2 more: Q9Z2L9, Q9Z2L9, D3ZUT8
>3 UniProt links 1 more: Q9Z2L9, D3ZUT8, D3Z831
>3 Interpro links 1 more: Q9Z2L9, D3ZUT8, D3Z831
>3 Prodom links 1 more: Q9Z2L9, D3ZUT8, D3Z831
>3 Pfam links 1 more: Q9Z2L9, D3ZUT8, D3Z831
>3 PIRSF links 1 more: Q9Z2L9, D3ZUT8, D3Z831
>3 SUPERFAM links 1 more: Q9Z2L9, D3ZUT8, D3Z831
Sequence
Graphical view for this peptide sequence: ratno-ndr4
Colored MSA for Ndr_family (raw)
MPECWDGEHDIETPYGLLHVVIRGSPKGNRPAILTYHDVGLNHKLCFNTL
FNLEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQFPSMEQLATMLPNVV
QHFGFKYVIGIGVGAGAYVLAKFALIFPDLVEGLVLMNIDPNGKGWIDWA
ATKLSGLTSTLPDTVLSHLFSQEELVNNTELVQSYRQQISSVVNQANLQL
FWNMYNSRRDLDINRPGTVPNAKTLRCPVMLVVGDNAPAEDGVVECNSKL
DPTTTTFLKMADSGGLPQVTQPGKLTEAFKYFLQGMGYIAHLKDRRLSGG
AVPSASMTRLARSRTASLTSASSVDGSRPQPCTHSDSSEGMGQVNHTMEV
SC
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPECWDGEHDIETPYGLLHVVIRGSPKGNRPAILTYHDVGLNHKLCFNTL
FNLEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQFPSMEQLATMLPNVV
QHFGFKYVIGIGVGAGAYVLAKFALIFPDLVEGLVLMNIDPNGKGWIDWA
ATKLSGLTSTLPDTVLSHLFSQEELVNNTELVQSYRQQISSVVNQANLQL
FWNMYNSRRDLDINRPGTVPNAKTLRCPVMLVVGDNAPAEDGVVECNSKL
DPTTTTFLKMADSGGLPQVTQPGKLTEAFKYFLQGMGYIAHLKDRRLSGG
AVPSASMTRLARSRTASLTSASSVDGSRPQPCTHSDSSEGMGQVNHTMEV
SC


References
    Title: Genomic organization, expression, and comparative analysis of noncoding region of the rat Ndrg4 gene
    Maeda A, Hongo S, Miyazaki A
    Ref: Gene, 324:149, 2004 : PubMed

            

    Title: Fold prediction and comparative modeling of Bdm1: a probable alpha/beta hydrolase associated with hot water epilepsy
    Bhaduri A, Krishnaswamy L, Ullal GR, Panicker MM, Sowdhamini R
    Ref: J Mol Model, 9:3, 2003 : PubMed

            

    Title: Molecular cloning and characterization of a novel developmentally regulated gene, Bdm1, showing predominant expression in postnatal rat brain
    Yamauchi Y, Hongo S, Nishinaka N, Ohashi T, Takahashi R, Takeda M, Shioda S, Zhou C, Nakai Y, Takeda F
    Ref: Brain Research Mol Brain Res, 68:149, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer