ratno-ppt

 
Rattus norvegicus (Rat) Palmitoyl-protein thioesterase 1

Relationship
Block X
Rattus norvegicus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Rattus: N E > Rattus norvegicus: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



1 Genbank : L34262
1 UniProt : P45479
1 UniProtTrembl : P45479
1 Interpro : P45479
1 Prodom : P45479
1 Pfam : P45479
1 PIRSF : P45479
1 SUPERFAM : P45479
1 QuickSwissBlast : P45479
 
Sequence
Graphical view for this peptide sequence: ratno-ppt
Colored MSA for Palmitoyl-protein_thioesterase (raw)
MASPGYRRLLAAALLPWCCAAWALGHLDPPSPPPLVIWHGMGDSCCNPMS
MGSIKKMVEKEIPGIYVLSLEIGKNMVEDVENSFFLNVNLQVGMACQILE
KDPKLQHGYNAIGFSQGGQFLRAVAQRCPTPPMMTLISVGGQHQGVFGLP
RCPGESSHICDFIRKSLNAGAYSKVVQERLVQAQYWHDPIKEEVYRNCSI
FLADINQERHINESYKENLMALKKFVMVKFFNDSIVDPVDSEWFGFYRSG
QAKETIPLQETTLYTEDRLGLKKMDKAGKLVFLAKEGDHLQISKEWFTAH
IIPFLK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MASPGYRRLLAAALLPWCCAAWALGHLDPPSPPPLVIWHGMGDSCCNPMS
MGSIKKMVEKEIPGIYVLSLEIGKNMVEDVENSFFLNVNLQVGMACQILE
KDPKLQHGYNAIGFSQGGQFLRAVAQRCPTPPMMTLISVGGQHQGVFGLP
RCPGESSHICDFIRKSLNAGAYSKVVQERLVQAQYWHDPIKEEVYRNCSI
FLADINQERHINESYKENLMALKKFVMVKFFNDSIVDPVDSEWFGFYRSG
QAKETIPLQETTLYTEDRLGLKKMDKAGKLVFLAKEGDHLQISKEWFTAH
IIPFLK

no DNA




References
    Title: Palmitoyl-protein thioesterase 1 (PPT1): an obesity-induced rat testicular marker of reduced fertility
    Liu Y, Zhao W, Gu G, Lu L, Feng J, Guo Q, Ding Z
    Ref: Mol Reprod Dev, 81:55, 2014 : PubMed

            

    Title: Molecular cloning and expression of palmitoyl-protein thioesterase
    Camp LA, Verkruyse LA, Afendis SJ, Slaughter CA, Hofmann SL
    Ref: Journal of Biological Chemistry, 269:23212, 1994 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer