ratno-q68g49

 
Rattus norvegicus (Rat) loc291863 protein

Comment
Q9QV18 short sequences


Relationship
Block C
Rattus norvegicus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Rattus: N E > Rattus norvegicus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



1 Genbank : BC078681
2 UniProt : Q68G49, P80250
2 UniProtTrembl : Q68G49, P80250
2 Interpro : Q68G49, P80250
2 Prodom : Q68G49, P80250
2 Pfam : Q68G49, P80250
2 PIRSF : Q68G49, P80250
2 SUPERFAM : Q68G49, P80250
2 QuickSwissBlast : Q68G49, P80250
 
Sequence
Graphical view for this peptide sequence: ratno-q68g49
Colored MSA for Carb_B_Chordata (raw)
MRLYPLVWLFLAACTAWGYPSSPPVVNTVKGKVLGKYVNLEGFAQPVAVF
LGIPFAKSPLGSLRFAPPQPAESWNFVKNTTSYPPMCSQDAVGGQVLSEL
FTNRKENIPLQFSEDCLYLNVYTPADLTKNSRLPVMVWIHGGGLVVGGSS
TYDGQALSAHENVVVVTIQYRLGIWGFFSTGDEHSQGNWGHLDQLAALHW
VQDNIANFGGNPGSVTIFGESAGGFSVSVLVLSPLAKNLFHRAISESGVS
LNTALITTDSKPIANLIATLSGCKTTTSAVMVHCLRQKTEDELLETSLKL
NLFKLDLFGNPKESYPFLPTVIDGVVLSKTPEEILAEKSFNTVPYIVGIN
KQEFGWIIPMLMGYPLSEGKLDQKTANSLLWKSYPTLKISEKMIPMASEK
YLGGTDDPAERKDLFKDLVADVIFGVPSVMVSRSHRDAGAPTFMYEFEYR
PSFVSAMRPKTVIGDHGDEIFSVFGSPFLKDGASEEETNLSKMVMKYWAN
FARNGNPNGGGLPHWPEYDQKEGYLKIGASTQAAQRLKDKEVAFWSELKA
KEAAEEPSHWKHVEL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRLYPLVWLFLAACTAWGYPSSPPVVNTVKGKVLGKYVNLEGFAQPVAVF
LGIPFAKSPLGSLRFAPPQPAESWNFVKNTTSYPPMCSQDAVGGQVLSEL
FTNRKENIPLQFSEDCLYLNVYTPADLTKNSRLPVMVWIHGGGLVVGGSS
TYDGQALSAHENVVVVTIQYRLGIWGFFSTGDEHSQGNWGHLDQLAALHW
VQDNIANFGGNPGSVTIFGESAGGFSVSVLVLSPLAKNLFHRAISESGVS
LNTALITTDSKPIANLIATLSGCKTTTSAVMVHCLRQKTEDELLETSLKL
NLFKLDLFGNPKESYPFLPTVIDGVVLSKTPEEILAEKSFNTVPYIVGIN
KQEFGWIIPMLMGYPLSEGKLDQKTANSLLWKSYPTLKISEKMIPMASEK
YLGGTDDPAERKDLFKDLVADVIFGVPSVMVSRSHRDAGAPTFMYEFEYR
PSFVSAMRPKTVIGDHGDEIFSVFGSPFLKDGASEEETNLSKMVMKYWAN
FARNGNPNGGGLPHWPEYDQKEGYLKIGASTQAAQRLKDKEVAFWSELKA
KEAAEEPSHWKHVEL

no DNA




References
    Title: Molecular aspects of carboxylesterase isoforms in comparison with other esterases
    Satoh T, Hosokawa M
    Ref: Toxicol Lett, 82-83:439, 1995 : PubMed

            

    Title: Purification and characterization of two rat liver microsomal carboxylesterases (hydrolase A and B)
    Morgan EW, Yan B, Greenway D, Petersen DR, Parkinson A
    Ref: Archives of Biochemistry & Biophysics, 315:495, 1994 : PubMed

            

    Title: Isolation and characterization of microsomal acyl-CoA thioesterase. A member of the rat liver microsomal carboxylesterase multi-gene family
    Alexson SE, Mentlein R, Wernstedt C, Hellman U
    Ref: European Journal of Biochemistry, 214 (3):719, 1993 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer