Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: ratno-q6mg55

Rattus norvegicus (Rat) hla-b associated transcript 5, rat orthologue

Relationship
Family|ABHD16
Block| X
Position in NCBI Life Tree|Rattus norvegicus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Rattus: N E > Rattus norvegicus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : BX883045, AC094348, CH474121
1 UniProt : Q6MG55
1 UniProt : Q6MG55
1 Interpro : Q6MG55
1 Pfam : Q6MG55
1 PIRSF : Q6MG55
1 SUPERFAM : Q6MG55
Sequence
Graphical view for this peptide sequence: ratno-q6mg55
Colored MSA for ABHD16 (raw)
MAKLLSCVLGPRLYKIYRERDTDRAATSVPETPTAVPAASSSSWDSYYQP
RALEKHADSILALASVFWSISYYSSPFAFFYLYRKGYLSLSKVVPFSHYA
GTLLVLLAGVACLRGIGRWTNPQYRQFITILEATHRNQSAENKRQLANYN
FDFRSWPVDFHWEEPSSRKGSRGGPSRRGVALLRPEPLHRGTADTFLNRV
KKLPCQITSYLVAHTLGRRMLYPGSVYLLQKALMPVLLQGQARLVEECNG
RRAKLLACDGNEIDTMFVDRRGTAEPQGQKLVICCEGNAGFYEVGCVSTP
LEAGYSVLGWNHPGFAGSTGVPFPQNEANAMDVVVQFAIHRLGFQPQDIV
IYAWSIGGFTATWAAMSYPDISAVILDASFDDLVPLALKVMPDSWRALVT
RTVRQHLNLNNAEQLCRFQGPVLLVRRTKDEIITTTVPEDIMSNRGNDLL
LKLLQFRYPRVMTEEGLRAVRQWLEASSQLEEASIYSRWEVDEDWCVSVL
RSYQAEHGPDFPWSVGEDMSVDGRRQLALFLARKHLHNFEATHCTPLPAQ
HFQMPWCL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAKLLSCVLGPRLYKIYRERDTDRAATSVPETPTAVPAASSSSWDSYYQP
RALEKHADSILALASVFWSISYYSSPFAFFYLYRKGYLSLSKVVPFSHYA
GTLLVLLAGVACLRGIGRWTNPQYRQFITILEATHRNQSAENKRQLANYN
FDFRSWPVDFHWEEPSSRKGSRGGPSRRGVALLRPEPLHRGTADTFLNRV
KKLPCQITSYLVAHTLGRRMLYPGSVYLLQKALMPVLLQGQARLVEECNG
RRAKLLACDGNEIDTMFVDRRGTAEPQGQKLVICCEGNAGFYEVGCVSTP
LEAGYSVLGWNHPGFAGSTGVPFPQNEANAMDVVVQFAIHRLGFQPQDIV
IYAWSIGGFTATWAAMSYPDISAVILDASFDDLVPLALKVMPDSWRALVT
RTVRQHLNLNNAEQLCRFQGPVLLVRRTKDEIITTTVPEDIMSNRGNDLL
LKLLQFRYPRVMTEEGLRAVRQWLEASSQLEEASIYSRWEVDEDWCVSVL
RSYQAEHGPDFPWSVGEDMSVDGRRQLALFLARKHLHNFEATHCTPLPAQ
HFQMPWCL


References
    Title: Gene and alternative splicing annotation with AIR
    Florea L, Di Francesco V, Miller J, Turner R, Yao A, Harris M, Walenz B, Mobarry C, Merkulov GV and Sutton G <5 more author(s)>
    Ref: Genome Res, 15:54, 2005 : PubMed

            

    Title: The genomic sequence and comparative analysis of the rat major histocompatibility complex
    Hurt P, Walter L, Sudbrak R, Klages S, Muller I, Shiina T, Inoko H, Lehrach H, Gunther E and Himmelbauer H <1 more author(s)>
    Ref: Genome Res, 14:631, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer