Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: rhidl-lipas

Rhizopus delemar Rhizopus oryzae mRNA for triacylglycerol lipase

Comment
Rhizopus delemar LIP_RHIDL, Rhizopus arrhizus, Rhizopus niveus gene for lipase AB013496 is identical to rhidl-lipas It is also Rhizopus oryzae. The sequence of Beer slightly different Rhizopus delemar LIP_RHIDL, Rhizopus arrhizus, Rhizopus niveus, gene for lipase AB013496 is identical to rhidl-lipas It is also Rhizopus oryzae. The sequence of Beer slightly different Rhizopus delemar LIP_RHIDL, Rhizopus arrhizus, Rhizopus niveus, gene for lipase AB013496 is identical to rhidl-lipas It is also Rhizopus oryzae. The sequence of Beer slightly different


Relationship
Family|Lipase_3
Block| L
Position in NCBI Life Tree|Rhizopus oryzae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Mucoromycota: N E > Mucoromycotina: N E > Mucorales: N E > Mucorineae: N E > Rhizopodaceae: N E > Rhizopus: N E > Rhizopus oryzae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
>3 Genbank links 5 more: M38352, D13206, S39525
3 UniProt : P61872, P61871, Q2QFX1
2 Ncbi-nid : 169737, 3327267
2 Ncbi-pid : 169738, 3299795
2 Structure : 1LGY, 1TIC
3 UniProt : P61871, P61872, Q2QFX1
3 Interpro : P61871, P61872, Q2QFX1
3 Prodom : P61871, P61872, Q2QFX1
3 Pfam : P61871, P61872, Q2QFX1
3 PIRSF : P61871, P61872, Q2QFX1
3 SUPERFAM : P61871, P61872, Q2QFX1
Sequence
Graphical view for this peptide sequence: rhidl-lipas
Colored MSA for Lipase_3 (raw)
MVSFISISQGVSLCLLVSSMMLGSSAVPVSGKSGSSNTAVSASDNAALPP
LISSRCAPPSNKGSKSDLQAEPYNMQKNTEWYESHGGNLTSIGKRDDNLV
GGMTLDLPSDAPPISLSSSTNSASDGGKVVAATTAQIQEFTKYAGIAATA
YCRSVVPGNKWDCVQCQKWVPDGKIITTFTSLLSDTNGYVLRSDKQKTIY
LVFRGTNSFRSAITDIVFNFSDYKPVKGAKVHAGFLSSYEQVVNDYFPVV
QEQLTAHPTYKVIVTGHSLGGAQALLAGMDLYQREPRLSPKNLSIFTVGG
PRVGNPTFAYYVESTGIPFQRTVHKRDIVPHVPPQSFGFLHPGVESWIKS
GTSNVQICTSEIETKDCSNSIVPFTSILDHLSYFDINEGSCL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVSFISISQGVSLCLLVSSMMLGSSAVPVSGKSGSSNTAVSASDNAALPP
LISSRCAPPSNKGSKSDLQAEPYNMQKNTEWYESHGGNLTSIGKRDDNLV
GGMTLDLPSDAPPISLSSSTNSASDGGKVVAATTAQIQEFTKYAGIAATA
YCRSVVPGNKWDCVQCQKWVPDGKIITTFTSLLSDTNGYVLRSDKQKTIY
LVFRGTNSFRSAITDIVFNFSDYKPVKGAKVHAGFLSSYEQVVNDYFPVV
QEQLTAHPTYKVIVTGHSLGGAQALLAGMDLYQREPRLSPKNLSIFTVGG
PRVGNPTFAYYVESTGIPFQRTVHKRDIVPHVPPQSFGFLHPGVESWIKS
GTSNVQICTSEIETKDCSNSIVPFTSILDHLSYFDINEGSCL


References
11 more
    Title: N-terminal peptide of Rhizopus oryzae lipase is important for its catalytic properties
    Sayari A, Frikha F, Miled N, Mtibaa H, Ben Ali Y, Verger R, Gargouri Y
    Ref: FEBS Letters, 579:976, 2005 : PubMed

            

    Title: Cloning, expression, characterization and role of the leader sequence of a lipase from Rhizopus oryzae
    Beer HD, McCarthy JE, Bornscheuer UT, Schmid RD
    Ref: Biochimica & Biophysica Acta, 1399:173, 1998 : PubMed

            

    Title: Cloning, expression and characterization of a cDNA encoding a lipase from Rhizopus delemar
    Haas MJ, Allen J, Berka TR
    Ref: Gene, 109:107, 1991 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer