Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: rhime-yack

Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) ORFA

Relationship
Family|Duf_3141
Block| X
Position in NCBI Life Tree|Sinorhizobium meliloti
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhizobiales: N E > Rhizobiaceae: N E > Sinorhizobium/Ensifer group: N E > Sinorhizobium: N E > Sinorhizobium meliloti: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AF095903
1 UniProt : Q9X447
1 UniProt : Q9X447
1 Interpro : Q9X447
1 Pfam : Q9X447
1 PIRSF : Q9X447
1 SUPERFAM : Q9X447
Sequence
Graphical view for this peptide sequence: rhime-yack
Colored MSA for Duf_3141 (raw)
MPEQSSIPTIPTLSDAYTYALDAWQRSILFLDVMRQRGAQYEEHTAQTAP
NVLDYEAELVCDGRKLDRPVNYALVRIVPPAGAVIDPLKKPFVVVDPRAG
HGPGIGGFKADSEIGVAIKAGHACYFIGFLPEPVPGQTIEDITRSEAIFL
ETVIARHPDADGKPCVIGNCQAGWAVMILASLRPELFGPIIIAGAPLSYW
AGIRGQYPMRYSGGLLGGSWLTALTGDLGAGIFDGAWLVQNFENQNPANT
LWTKQYNLYSKVDTEAGRYLGFERWWGGHVRLNAEEMQFIVDELFVGNKL
AAGKIQTSDGTTIDMRNIRSPIVVFCSKGDNITPPAQALDWILDLHDSVD
EIRAHGQTIVYTVHEKIGHLGIFVSAGVARKEHDEFASNIDLIDVLPPGL
YEAVLEPVGPAVENPDLVSGEWIMRCEARTLDDIRAFGGNDLEDDRRFAA
AARVSEINLALYRTYLQPWIKGMVTPPMAEAMRSMHPLRLQYEVFGPGNP
VMAWVEAAAGLIRDARQPVAPDNPLLALQENMSRQVVDGLEAWRQMVEHL
SEQKFREIYGAPALQAALGIDTQTDRPPRQAAKNCWHHALLENKIAALKA
DMAKGGIREALARALLFVGMARGRVDERGFEAVRRLRRAHPSAKQLTLAE
FKALMRTQYFMLLVDEEAALAAIPKLLPEKIEERGAAFAALREVLEAPGL
LTGIAAERLQSVKALFGLSGEAPVPLMVRKVAR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPEQSSIPTIPTLSDAYTYALDAWQRSILFLDVMRQRGAQYEEHTAQTAP
NVLDYEAELVCDGRKLDRPVNYALVRIVPPAGAVIDPLKKPFVVVDPRAG
HGPGIGGFKADSEIGVAIKAGHACYFIGFLPEPVPGQTIEDITRSEAIFL
ETVIARHPDADGKPCVIGNCQAGWAVMILASLRPELFGPIIIAGAPLSYW
AGIRGQYPMRYSGGLLGGSWLTALTGDLGAGIFDGAWLVQNFENQNPANT
LWTKQYNLYSKVDTEAGRYLGFERWWGGHVRLNAEEMQFIVDELFVGNKL
AAGKIQTSDGTTIDMRNIRSPIVVFCSKGDNITPPAQALDWILDLHDSVD
EIRAHGQTIVYTVHEKIGHLGIFVSAGVARKEHDEFASNIDLIDVLPPGL
YEAVLEPVGPAVENPDLVSGEWIMRCEARTLDDIRAFGGNDLEDDRRFAA
AARVSEINLALYRTYLQPWIKGMVTPPMAEAMRSMHPLRLQYEVFGPGNP
VMAWVEAAAGLIRDARQPVAPDNPLLALQENMSRQVVDGLEAWRQMVEHL
SEQKFREIYGAPALQAALGIDTQTDRPPRQAAKNCWHHALLENKIAALKA
DMAKGGIREALARALLFVGMARGRVDERGFEAVRRLRRAHPSAKQLTLAE
FKALMRTQYFMLLVDEEAALAAIPKLLPEKIEERGAAFAALREVLEAPGL
LTGIAAERLQSVKALFGLSGEAPVPLMVRKVAR


Reference
    Title: Genes coding for phosphotransacetylase and acetate kinase in Sinorhizobium meliloti are in an operon that is inducible by phosphate stress and controlled by phoB
    Summers ML, Denton MC, McDermott TR
    Ref: Journal of Bacteriology, 181:2217, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer