Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: rhimi-lipas

Rhizomucor miehei protein for triacylglycerol lipase (Lipozyme RM IM)

Comment
Novozym 40086 is a 1,3 specific lipase originating from Rhizomucor mehei which is immobilized on a resin carrier. Novozym 40086 is a highly effective catalyst for stereoselective transesterification and ester hydrolysis. Anion-exchange resin inmobilized Lipozyme RM IM


Relationship
Family|Lipase_3
Block| L
Position in NCBI Life Tree|Rhizomucor miehei
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Mucoromycota: N E > Mucoromycotina: N E > Mucorales: N E > Lichtheimiaceae: N E > Rhizomucor: N E > Rhizomucor miehei: N E


Molecular evidence
Database
No mutation
6 structures (e.g. : 1TGL, 3TGL, 4TGL... more)
No kinetic





9 substrates (e.g. : C8-DGDG, C8-MGDG, Egg-Lecithin... more)
3 inhibitors: Caffeine, N-Hexylphosphonate-Ethyl-Ester, Paraoxon
1 UniProt : P19515
>3 Structure links 3 more: 6QPR, 6QPP, 1TGL
1 UniProt : P19515
1 Interpro : P19515
1 Prodom : P19515
1 Pfam : P19515
1 PIRSF : P19515
1 SUPERFAM : P19515
Sequence
Graphical view for this peptide sequence: rhimi-lipas
Colored MSA for Lipase_3 (raw)
MVLKQRANYLGFLIVFFTAFLVEAVPIKRQSNSTVDSLPPLIPSRTSAPS
SSPSTTDPEAPAMSRNGPLPSDVETKYGMALNATSYPDSVVQAMSIDGGI
RAATSQEINELTYYTTLSANSYCRTVIPGATWDCIHCDATEDLKIIKTWS
TLIYDTNAMVARGDSEKTIYIVFRGSSSIRNWIADLTFVPVSYPPVSGTK
VHKGFLDSYGEVQNELVATVLDQFKQYPSYKVAVTGHSLGGATALLCALD
LYQREEGLSSSNLFLYTQGQPRVGDPAFANYVVSTGIPYRRTVNERDIVP
HLPPAAFGFLHAGEEYWITDNSPETVQVCTSDLETSDCSNSIVPFTSVLD
HLSYFGINTGLCT
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVLKQRANYLGFLIVFFTAFLVEAVPIKRQSNSTVDSLPPLIPSRTSAPS
SSPSTTDPEAPAMSRNGPLPSDVETKYGMALNATSYPDSVVQAMSIDGGI
RAATSQEINELTYYTTLSANSYCRTVIPGATWDCIHCDATEDLKIIKTWS
TLIYDTNAMVARGDSEKTIYIVFRGSSSIRNWIADLTFVPVSYPPVSGTK
VHKGFLDSYGEVQNELVATVLDQFKQYPSYKVAVTGHSLGGATALLCALD
LYQREEGLSSSNLFLYTQGQPRVGDPAFANYVVSTGIPYRRTVNERDIVP
HLPPAAFGFLHAGEEYWITDNSPETVQVCTSDLETSDCSNSIVPFTSVLD
HLSYFGINTGLCT


References
6 more
    Title: Enzymatic structural modification of monogalactosyldiacylglycerols for potential modulation of hydrophile-lipophile balance
    Roh S, Lee S, Kim IH, Hee Kim B
    Ref: Food Chem, 385:132705, 2022 : PubMed

            

    Title: Effect of propeptide mutations on the directed evolution of Rhizomucor miehei lipase
    Wang J, Bai R, Wu N, Zhang Y, Hu L
    Ref: Protein Pept Lett, :, 2022 : PubMed

            

    Title: Enhanced activity of Rhizomucor miehei lipase by directed evolution with simultaneous evolution of the propeptide
    Wang J, Wang D, Wang B, Mei ZH, Liu J, Yu HW
    Ref: Applied Microbiology & Biotechnology, 96:443, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer