Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: rhom4-d0mhy8

Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) (Rhodothermus obamensis) Rmar_1206 esterase in n-term of a OsmC family domain

Comment
this esterase is found in n-term of an OsmC/Ohr family domain excluded here


Relationship
Family|Est-OsmC
Block| X
Position in NCBI Life Tree|Rhodothermus marinus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > FCB group: N E > Bacteroidetes/Chlorobi group: N E > Bacteroidetes: N E > Bacteroidetes Order II. Incertae sedis: N E > Rhodothermaceae: N E > Rhodothermus: N E > Rhodothermus marinus: N E


Molecular evidence
Database
No mutation
1 structure:
5CML: Crystal structure of the Esterase domain from Rhodothermus marinus Rmar_1206 protein
No kinetic





No Substrate
No inhibitor
1 Genbank : CP001807
1 UniProt : D0MHY8
1 Structure : 5CML
1 UniProt : D0MHY8
1 Interpro : D0MHY8
1 Prodom : D0MHY8
1 Pfam : D0MHY8
1 PIRSF : D0MHY8
1 SUPERFAM : D0MHY8
Sequence
Graphical view for this peptide sequence: rhom4-d0mhy8
Colored MSA for Est-OsmC (raw)
MQIKTVTFENNRGERLAARLDLPVDTQPVAYALFAHCFTCSKNLKAVTTI
SRALTTQGYAVLRFDFTGLGESEGDFSETTFATNFEDLRAACRFLSAQYE
PPALLIGHSLGGAAVLAVAGEFPEVKAVATIGAPCDPAHVRHLLRPALDT
IKTVGEAVVDLGGRPFRIKKQFLEELERVNLEDQVRTMRRPLLLFHSPTD
QIVGIENAACLFQAARHPKSFVSLDQADHLLSNSDDAAFVGEVLGAWARR
YV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQIKTVTFENNRGERLAARLDLPVDTQPVAYALFAHCFTCSKNLKAVTTI
SRALTTQGYAVLRFDFTGLGESEGDFSETTFATNFEDLRAACRFLSAQYE
PPALLIGHSLGGAAVLAVAGEFPEVKAVATIGAPCDPAHVRHLLRPALDT
IKTVGEAVVDLGGRPFRIKKQFLEELERVNLEDQVRTMRRPLLLFHSPTD
QIVGIENAACLFQAARHPKSFVSLDQADHLLSNSDDAAFVGEVLGAWARR
YV


References
    Title: Characterisation of a New Family of Carboxyl Esterases with an OsmC Domain
    Jensen MV, Horsfall LE, Wardrope C, Togneri PD, Marles-Wright J, Rosser SJ
    Ref: PLoS ONE, 11:e0166128, 2016 : PubMed

            

    Title: Complete genome sequence of Rhodothermus marinus type strain (R-10)
    Nolan M, Tindall BJ, Pomrenke H, Lapidus A, Copeland A, Glavina Del Rio T, Lucas S, Chen F, Tice H and Detter JC <25 more author(s)>
    Ref: Stand Genomic Sci, 1:283, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer