Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: rhoop-pcaL

Rhodococcus opacus (Nocardia opaca), Rhodococcus sp., Rhodococcus wratislaviensis, Rhodococcus imtechensis, 3-oxoadipate enol-lactone hydrolase (pcaL)

Comment
Other strains: Rhodococcus opacus (Nocardia opaca) (B4; PD630; M213) Rhodococcus sp. (DK17; RHA1; JVH1); Rhodococcus wratislaviensis (IFP 2016; NBRC 100605); Rhodococcus imtechensis RKJ300 = JCM 13270 PcaL; single polypeptide combining 3-oxoadipate enol-lactone hydrolyzing and 4-carboxymuconolactone decarboxylating activity


Relationship
Family|Carboxymethylbutenolide_lactonase
Block| X
Position in NCBI Life Tree|Rhodococcus opacus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Nocardiaceae: N E > Rhodococcus: N E > Rhodococcus opacus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: rhoop-pcaL
Colored MSA for Carboxymethylbutenolide_lactonase (raw)
MTVALAHEISGPRNGAADAPVVVLLGSLGSNRSMWDPQIAALSDECRVVA
VDQRGHGESPAPDGPYSVRDLSEDVLALLDSLGVDAAHFVGLSMGGAIAQ
WLGAHTPRRVLSLSLLCTAAKFGEPQAWTERAAASRTDGPESLADAVVAR
WFSEGFAKRDPEFVRHYREMIASTSPEGYAACCDALADWDFTADLSRISA
PTLVIAGEEDPSTPPSVMQILADGITGARFEVLSPAAHVANLEQAGAVTA
LLREHIA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTVALAHEISGPRNGAADAPVVVLLGSLGSNRSMWDPQIAALSDECRVVA
VDQRGHGESPAPDGPYSVRDLSEDVLALLDSLGVDAAHFVGLSMGGAIAQ
WLGAHTPRRVLSLSLLCTAAKFGEPQAWTERAAASRTDGPESLADAVVAR
WFSEGFAKRDPEFVRHYREMIASTSPEGYAACCDALADWDFTADLSRISA
PTLVIAGEEDPSTPPSVMQILADGITGARFEVLSPAAHVANLEQAGAVTA
LLREHIA


References
2 more
    Title: Draft Genome Sequence of Rhodococcus opacus Strain M213 Shows a Diverse Catabolic Potential
    Pathak A, Green SJ, Ogram A, Chauhan A
    Ref: Genome Announc, 1:, 2013 : PubMed

            

    Title: The complete genome of Rhodococcus sp. RHA1 provides insights into a catabolic powerhouse
    McLeod MP, Warren RL, Hsiao WW, Araki N, Myhre M, Fernandes C, Miyazawa D, Wong W, Lillquist AL and Eltis LD <19 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 103:15582, 2006 : PubMed

            

    Title: Characterization of a protocatechuate catabolic gene cluster from Rhodococcus opacus 1CP: evidence for a merged enzyme with 4-carboxymuconolactone-decarboxylating and 3-oxoadipate enol-lactone-hydrolyzing activity
    Eulberg D, Lakner S, Golovleva LA, Schlomann M
    Ref: Journal of Bacteriology, 180:1072, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer