Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: rhopa-q6n9m9

Rhodopseudomonas palustris alpha/beta hydrolase fold RPA1511

Comment
Other strains: Rhodopseudomonas palustris (strain TIE-1) The wide-open active site cleft is occupied by PEG400 in place of Polylactic-acid


Relationship
Family|Mg-chelatase_BchO
Block| X
Position in NCBI Life Tree|Rhodopseudomonas palustris
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhizobiales: N E > Bradyrhizobiaceae: N E > Rhodopseudomonas: N E > Rhodopseudomonas palustris: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
4PSU: Crystal structure of alpha/beta hydrolase RPA1511 from Rhodopseudomonas palustris CGA009
No kinetic





1 substrate:
Polylactic-acid
No inhibitor
2 Genbank : BX572597, CP001096
2 UniProt : Q6N9M9, B3Q792
1 Structure : 4PSU
2 UniProt : Q6N9M9, B3Q792
2 Interpro : Q6N9M9, B3Q792
2 Prodom : Q6N9M9, B3Q792
2 Pfam : Q6N9M9, B3Q792
2 PIRSF : Q6N9M9, B3Q792
2 SUPERFAM : Q6N9M9, B3Q792
Sequence
Graphical view for this peptide sequence: rhopa-q6n9m9
Colored MSA for Mg-chelatase_BchO (raw)
MSDLVWSRDGLDWPHREASRFIEAGGFRWHVQRMGSPAAPAILLIHGTGA
ASHSWRGLAPLLSRHYHVVAPDLPGHGFTQTPRGHRMSLPGMASDLAALL
RVLQVAPQLVVGHSAGAAILARMCLDGSIDPKILFSLNGAFLPYGGPAAS
FFSPLAKMLVMNPFVPSLFAWQAGHRGAVERLIGNTGSTIDPAGIKLYGK
LVSSPNHVAAALRMMANWDLEPLLKALPNLKPLLVLVAAEGDRAIPPSVA
VKVREILPKAVIERIPALGHLAHEERPALIAALIERYAEKLENIE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSDLVWSRDGLDWPHREASRFIEAGGFRWHVQRMGSPAAPAILLIHGTGA
ASHSWRGLAPLLSRHYHVVAPDLPGHGFTQTPRGHRMSLPGMASDLAALL
RVLQVAPQLVVGHSAGAAILARMCLDGSIDPKILFSLNGAFLPYGGPAAS
FFSPLAKMLVMNPFVPSLFAWQAGHRGAVERLIGNTGSTIDPAGIKLYGK
LVSSPNHVAAALRMMANWDLEPLLKALPNLKPLLVLVAAEGDRAIPPSVA
VKVREILPKAVIERIPALGHLAHEERPALIAALIERYAEKLENIE


References
    Title: Biochemical and Structural Insights into Enzymatic Depolymerization of Polylactic Acid and Other Polyesters by Microbial Carboxylesterases
    Hajighasemi M, Nocek BP, Tchigvintsev A, Brown G, Flick R, Xu X, Cui H, Hai T, Joachimiak A and Yakunin AF <3 more author(s)>
    Ref: Biomacromolecules, 17:2027, 2016 : PubMed

            

    Title: Complete genome sequence of the metabolically versatile photosynthetic bacterium Rhodopseudomonas palustris
    Larimer FW, Chain P, Hauser L, Lamerdin J, Malfatti S, Do L, Land ML, Pelletier DA, Beatty JT and Harwood CS <9 more author(s)>
    Ref: Nat Biotechnol, 22:55, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer