Gene_locus Report for: rhopa-q6n9m9

Rhodopseudomonas palustris alpha/beta hydrolase fold RPA1511

Comment

Other strains: Rhodopseudomonas palustris (strain TIE-1) The wide-open active site cleft is occupied by PEG400 in place of Polylactic-acid

Relationship

Family	\|	Mg-chelatase_BchO
Block	\|	X
Position in NCBI Life Tree	\|	Rhodopseudomonas palustris

(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhizobiales: N E > Bradyrhizobiaceae: N E > Rhodopseudomonas: N E > Rhodopseudomonas palustris: N E

There are 200 a/b hydrolases in Rhodopseudomonas palustris view in a: Table

5_AlphaBeta_hydrolase : rhopa-q6ncc5Rhodopseudomonas palustris hypothetical protein.
6_AlphaBeta_hydrolase : rhop2-q2ir22Rhodopseudomonas palustris (strain HaA2) alpha/beta hydrolase, rhop2-q2ish7Rhodopseudomonas palustris (strain HaA2) alpha/beta hydrolase protein, rhop2-q2isv4Rhodopseudomonas palustris (strain HaA2) alpha/beta hydrolase, rhop2-q2it83Rhodopseudomonas palustris (strain HaA2) alpha/beta hydrolase precursor, rhop2-q2iv26Rhodopseudomonas palustris (strain HaA2) alpha/beta hydrolase precursor, rhop2-q2ivt3Rhodopseudomonas palustris (strain HaA2) alpha/beta hydrolase, rhop2-q2iy70Rhodopseudomonas palustris (strain HaA2) alpha/beta hydrolase, rhop2-q2j0t0Rhodopseudomonas palustris (strain HaA2) alpha/beta hydrolase, rhop2-q2j1a1Rhodopseudomonas palustris (strain HaA2) alpha/beta hydrolase, rhop2-q2j080Rhodopseudomonas palustris (strain HaA2) alpha/beta hydrolase precursor, rhop5-q07j45Rhodopseudomonas palustris (strain BisA53) alpha/beta hydrolase fold precursor, rhop5-q07jk3Rhodopseudomonas palustris (strain BisA53) alpha/beta hydrolase fold precursor, rhop5-q07kg3Rhodopseudomonas palustris (strain BisA53) alpha/beta hydrolase fold precursor, rhop5-q07mb5Rhodopseudomonas palustris (strain BisA53) alpha/beta hydrolase fold, rhop5-q07p83Rhodopseudomonas palustris (strain BisA53) alpha/beta hydrolase fold, rhop5-q07s19Rhodopseudomonas palustris (strain BisA53) Putative uncharacterized protein, rhop5-q07te8Rhodopseudomonas palustris (strain BisA53) alpha/beta hydrolase fold, rhop5-q07uc4Rhodopseudomonas palustris (strain BisA53) alpha/beta hydrolase fold, rhop5-q07uk8Rhodopseudomonas palustris (strain BisA53) Alpha/beta hydrolase fold, rhopa-q6n4a9Rhodopseudomonas palustris possible hydrolase, rhopa-q6n5y2Rhodopseudomonas palustris possible hydrolase, rhopa-q6n6i9Rhodopseudomonas palustris possible hydrolase precursor, rhopa-q6n7z8Rhodopseudomonas palustris Putative uncharacterized protein, rhopa-q6n9a2Rhodopseudomonas palustris putative esterase precursor, rhopa-q6n9n0Rhodopseudomonas palustris (and strain TIE-1) hypothetical protein, rhopa-q6n255Rhodopseudomonas palustris putative hydrolase precursor, rhopa-q6naa8Rhodopseudomonas palustris possible beta-ketoadipate enol-lactone hydrolase, rhopa-q6nah3Rhodopseudomonas palustris (and strain TIE-1) alpha/beta hydrolase fold, rhopa-q6nb34Rhodopseudomonas palustris alpha/beta hydrolase fold, rhopa-q6nc00Rhodopseudomonas palustris possible hydrolases (alpha/beta hydrolase superfamily), rhopa-q6ncw9Rhodopseudomonas palustris possible hydrolase, rhopb-q20yi3Rhodopseudomonas palustris (strain BisB18) alpha/beta hydrolase fold, rhopb-q20zc3Rhodopseudomonas palustris (strain BisB18) alpha/beta hydrolase fold precursor, rhopb-q20zs3Rhodopseudomonas palustris (strain BisB18) alpha/beta hydrolase fold precursor, rhopb-q21a20Rhodopseudomonas palustris (strain BisB18) dipeptidyl aminopeptidases/acylaminoacyl-peptidases-like precursor, rhopb-q21aq5Rhodopseudomonas palustris (strain BisB18) alpha/beta hydrolase fold, rhopb-q21bs6Rhodopseudomonas palustris (strain BisB18) alpha/beta hydrolase fold precursor, rhopb-q21ch1Rhodopseudomonas palustris (strain BisB18) alpha/beta hydrolase fold, rhopb-q21cq3Rhodopseudomonas palustris (strain BisB18) alpha/beta hydrolase fold, rhopb-q212g8Rhodopseudomonas palustris (strains BisB18; BisA53) Rhodopseudomonas palustris BisA53 alpha/beta hydrolase fold precursor, rhopb-q212j8Rhodopseudomonas palustris (strain BisB18) alpha/beta hydrolase fold, rhopb-q213z9Rhodopseudomonas palustris (strain BisB18) alpha/beta hydrolase fold precursor, rhopb-q216u6Rhodopseudomonas palustris (strain BisB18) alpha/beta hydrolase fold precursor, rhopb-q219p4Rhodopseudomonas palustris (strain BisB18) alpha/beta hydrolase fold, rhopb-q219w5Rhodopseudomonas palustris (strain BisB18) Putative uncharacterized protein, rhops-q13b34Rhodopseudomonas palustris (strain BisB5) alpha/beta hydrolase fold, rhops-q13ba2Rhodopseudomonas palustris (strain BisB5) alpha/beta hydrolase fold, rhops-q13bx0Rhodopseudomonas palustris (strain BisB5) alpha/beta hydrolase fold, rhops-q13cs2Rhodopseudomonas palustris (strain BisB5) alpha/beta hydrolase fold, rhops-q13et0Rhodopseudomonas palustris (strain BisB5) putative uncharacterized protein, rhops-q132k0Rhodopseudomonas palustris (strain BisB5) Alpha/beta hydrolase fold, rhops-q132p9Rhodopseudomonas palustris (strain BisB5) alpha/beta hydrolase fold, rhops-q134h6Rhodopseudomonas palustris (strain BisB5) alpha/beta hydrolase fold, rhopt-b3q884Rhodopseudomonas palustris (strain TIE-1) Putative uncharacterized protein, rhopt-b3qd68Rhodopseudomonas palustris (strain TIE-1) Alpha/beta hydrolase fold, rhopt-b3qej5Rhodopseudomonas palustris (strain TIE-1) Putative uncharacterized protein.
A85-EsteraseD-FGH : rhop5-q07hi4Rhodopseudomonas palustris (strain BisA53) Carboxylesterase, rhopb-q21d58Rhodopseudomonas palustris (strain BisB18) carboxylesterase (EC 3.1.1.1).
A85-IroE-IroD-Fes-Yiel : rhopb-q210n9Rhodopseudomonas palustris (strain BisB18) putative esterase precursor.
abh_upf0017 : rhop2-q2j250Rhodopseudomonas palustris (strain HaA2) Putative uncharacterized protein, rhop5-q07th3Rhodopseudomonas palustris (strain BisA53) Alpha/beta hydrolase fold, rhopa-q6nbx2Rhodopseudomonas palustris (and strain TIE-1; DX-1) Putative uncharacterized protein, rhopb-q213f2Rhodopseudomonas palustris (strain BisB18) alpha/beta hydrolase fold, rhops-q13df3Rhodopseudomonas palustris (strain BisB5) Putative uncharacterized protein.
Aclacinomycin-methylesterase_RdmC : rhopb-q218g8Rhodopseudomonas palustris (strain BisB18) alpha/beta hydrolase fold.
AHL-acylase : rhop2-q2j0u2Rhodopseudomonas palustris (strain HaA2) alpha/beta hydrolase.
AlphaBeta_hydrolase : rhop2-q2isu7Rhodopseudomonas palustris (strain HaA2) hypothetical protein precursor, rhopb-q211k5Rhodopseudomonas palustris (strain BisB18) alpha/beta hydrolase fold precursor, rhopb-q219x7Rhodopseudomonas palustris (strain BisB18) dienelactone hydrolase.
Atu1826-like : rhop2-q2ivr2Rhodopseudomonas palustris; Rhodopseudomonas sp.; Bradyrhizobium erythrophlei hypothetical protein, rhop5-q07mc7Rhodopseudomonas palustris (strain BisA53) putative uncharacterized protein, rhopa-q6n701Rhodopseudomonas palustris (and BisB5) hypothetical protein, rhopb-q213p5Rhodopseudomonas palustris; Bradyrhizobium ottawaense; Afipia sp.; B. canariense; B. erythrophle; B. lablabi; Rhizobiales bacterium, hypothetical protein.
BD-FAE : rhop2-q2ivf6Rhodopseudomonas palustris (strain HaA2) esterase/lipase/thioesterase.
CarbLipBact_2 : rhop2-q2iuy6Rhodopseudomonas palustris (strain HaA2) alpha/beta hydrolase, rhopa-q6n0w4Rhodopseudomonas palustris (and strain TIE-1; DX-1) putative carboxylesterase (EC 3.1.1.1).
Carboxymethylbutenolide_lactonase : rhop5-q07r32Rhodopseudomonas palustris (strain BisA53) 3-oxoadipate enol-lactonase (EC 3.1.1.24), rhopb-q218j5Rhodopseudomonas palustris (strain BisB18) 3-oxoadipate enol-lactonase.
Carboxypeptidase_S10 : rhop2-q2j309Rhodopseudomonas palustris (strain HaA2) peptidase s10, serine carboxypeptidase precursor, rhopa-q6ncx3Rhodopseudomonas palustris hypothetical protein precursor, rhopb-q212m6Rhodopseudomonas palustris (strain BisB18) peptidase s10, serine carboxypeptidase precursor.
Carb_B_Bacteria : rhop5-q07sq8Rhodopseudomonas palustris (strain BisA53) carboxylesterase, type b precursor, rhop5-q07v24Rhodopseudomonas palustris (strain BisA53) carboxylesterase, type b, rhopa-3873Rhodopseudomonas palustris Rpal_1 gene Rpal3873 (and strain TIE-1) from whole genome, rhopa-RPA3893Rhodopseudomonas palustris (and strain TIE-1) putative carboxylesterase (EC 3.1.1.1).
CFTR-inhibitory-factor_Cif : rhop5-q07i22Rhodopseudomonas palustris (strain BisA53) Alpha/beta hydrolase fold.
Chlorophyllase : rhop2-q2iss7Rhodopseudomonas palustris (strain HaA2) putative uncharacterized protein precursor, rhop2-q2ixg5Rhodopseudomonas palustris (strain HaA2) hypothetical protein precursor, rhopa-q6n530Rhodopseudomonas palustris hypothetical protein precursor, rhops-q135f2Rhodopseudomonas palustris (strain BisB5) putative uncharacterized protein precursor, rhopb-q219z4Rhodopseudomonas palustris (strain BisB18). Uncharacterized protein.
Cocaine_esterase : rhop2-q2ive8Rhodopseudomonas palustris (strain HaA2) peptidase s15.
Dienelactone_hydrolase : rhop2-q2isf5Rhodopseudomonas palustris (strain HaA2) dienelactone hydrolase, rhop2-q2iyz4Rhodopseudomonas palustris (strain HaA2) dienelactone hydrolase precursor, rhop2-q2j0u8Rhodopseudomonas palustris (strain HaA2) carboxymethylenebutenolidase (EC 3.1.1.45), rhopa-q6n0d1Rhodopseudomonas palustris putative dienelactone hydrolase (EC 3.1.1.45), rhopa-q6n4x3Rhodopseudomonas palustris family, rhopa-q6naj1Rhodopseudomonas palustris putative carboxymethylenebutenolidase, rhopb-q20xb2Rhodopseudomonas palustris (strain BisB18) dienelactone hydrolase, rhopb-q21au0Rhodopseudomonas palustris (strain BisB18) carboxymethylenebutenolidase (EC 3.1.1.45).
Duf_676 : rhop2-q2itw9Rhodopseudomonas palustris (strain HaA2) hypothetical protein.
Duf_1100-S : rhopa-q6nb93Rhodopseudomonas palustris hypothetical protein precursor.
Duf_3141 : rhop5-q07lt7Rhodopseudomonas palustris (strain BisA53) Putative uncharacterized protein, rhopt-b3qg39Rhodopseudomonas palustris (strain TIE-1) Putative uncharacterized protein.
Epoxide_hydrolase : rhop2-q2it06Rhodopseudomonas palustris (strain HaA2) alpha/beta hydrolase superfamily protein, rhop2-q2iwn1Rhodopseudomonas palustris (strain HaA2) alpha/beta hydrolase, rhop2-q2iwr3Rhodopseudomonas palustris (strain HaA2) alpha/beta hydrolase, rhop5-q07mn4Rhodopseudomonas palustris (strain BisA53) Alpha/beta hydrolase fold, rhop5-q07mt0Rhodopseudomonas palustris (strain BisA53) Alpha/beta hydrolase fold, rhop5-q07rw8Rhodopseudomonas palustris (strain BisA53) alpha/beta hydrolase fold, rhopa-q6n3g3Rhodopseudomonas palustris Alpha/beta hydrolase fold:Esterase/lipase/thioesterase, active site, rhopa-q6n9i1Rhodopseudomonas palustris possible carboxylesterase (EC 3.1.1.1), rhopa-q6n645Rhodopseudomonas palustris (and strain TIE-1) epoxide hydrolase (EC 3.3.2.3) Rpaeh2, rhopa-q6n684Rhodopseudomonas palustris possible epoxide hydrolase-related protein, rhopb-q218g9Rhodopseudomonas palustris (strain BisB18) alpha/beta hydrolase fold, rhops-q13a34Rhodopseudomonas palustris (strain BisB5) Alpha/beta hydrolase fold, rhops-q136p7Rhodopseudomonas palustris (strain BisB5) Alpha/beta hydrolase fold, rhops-q136t1Rhodopseudomonas palustris (strain BisB5) Alpha/beta hydrolase fold, rhopt-b3qdz6Rhodopseudomonas palustris (strain TIE-1) Alpha/beta hydrolase fold, rhopt-b3qjl5Rhodopseudomonas palustris (strain TIE-1) Alpha/beta hydrolase fold.
Est-OsmC : rhop5-q07qz8Rhodopseudomonas palustris (strain BisA53) esterase is found in n-term of an OsmC/Ohr family domain, rhopa-q6n920Rhodopseudomonas palustris esterase is found in n-term of an OsmC/Ohr family domain, rhopl-a0a0d7e2y7Rhodopseudomonas palustris esterase found in n-term of an OsmC/Ohr family domain, rhops-q13a18Rhodopseudomonas palustris (strain BisB5) esterase found in n-term of an OsmC/Ohr family domain, rhopb-q218f3Rhodopseudomonas palustris (strain BisB18) esterase found in n-term of an OsmC/Ohr family domain, rhop2-q2ity2Rhodopseudomonas palustris (strain HaA2) esterase found in n-term of an OsmC/Ohr family domain.
Fungal-Bact_LIP : rhopa-q6n4n9Rhodopseudomonas palustris (strains ATCC BAA-98 / CGA009; DX-1; TIE-1) Putative uncharacterized protein, rhopb-q21bs7Rhodopseudomonas palustris (strain BisB18) secretory lipase precursor.
Haloacetate_dehalogenase : rhop2-q2iyy8Rhodopseudomonas palustris (strain HaA2) alpha/beta hydrolase, rhopa-q6nam1

Rhodopseudomonas palustris (and strains BisB5; TIE-1) RPA1163 possible epoxide hydrolase, rhops-q131b7Rhodopseudomonas palustris (strain BisB5) Alpha/beta hydrolase fold.
Haloperoxidase : rhop2-q2j3q5Rhodopseudomonas palustris (strain HaA2) alpha/beta hydrolase, rhop2-q2j3r4Rhodopseudomonas palustris (strain HaA2) alpha/beta hydrolase, rhop5-q07i24Rhodopseudomonas palustris (strain BisA53) alpha/beta hydrolase fold, rhopa-q6n7z9Rhodopseudomonas palustris (and strain TIE-1) non-heme chloroperoxidase (EC 1.11.1.-), rhopb-q20y43Rhodopseudomonas palustris (strain BisB18) alpha/beta hydrolase fold, rhopb-q212g7Rhodopseudomonas palustris (strain BisB18) (strain BisA53) and (strain HaA2) alpha/beta hydrolase fold chloride peroxidase (EC 1.11.1.10), rhopt-b3qk37Rhodopseudomonas palustris (strain TIE-1) Alpha/beta hydrolase fold.
Homoserine_transacetylase : rhop2-q2is70Rhodopseudomonas palustris (strain HaA2) homoserine o-acetyltransferase (EC 2.3.1.31), rhop5-q07ih0Rhodopseudomonas palustris (strain BisA53) Homoserine O-acetyltransferase, rhopa-metxRhodopseudomonas palustris Homoserine O-trans-acetylase, rhopb-q20yi1Rhodopseudomonas palustris (strain BisB18) homoserine o-acetyltransferase (EC 2.3.1.31), rhops-q131c1Rhodopseudomonas palustris (strain BisB5) Homoserine O-acetyltransferase.
Hormone-sensitive_lipase_like : rhop2-q2ivn0Rhodopseudomonas palustris (strain HaA2) esterase/lipase/thioesterase, rhopa-q6n738Rhodopseudomonas palustris putative lipase/esterase, rhopl-a0a0d7ehn7Rhodopseudomonas palustris Acetyl hydrolase.
Mg-chelatase_BchO : rhop2-q2isv5Rhodopseudomonas palustris (strain HaA2) alpha/beta hydrolase, rhop2-q2j2x3Rhodopseudomonas palustris (strain HaA2) alpha/beta hydrolase, rhopa-q6ncx2Rhodopseudomonas palustris . Magnesium chelatase accessory protein bcho, rhopb-q21bv3Rhodopseudomonas palustris (strain BisB18) alpha/beta hydrolase fold, rhopb-q219w4Rhodopseudomonas palustris (strain BisB18) alpha/beta hydrolase fold, rhopl-a0a0d7dyb9Rhodopseudomonas palustris. Alpha/beta hydrolase, rhopx-e6vi28Rhodopseudomonas palustris (strain DX-1). Magnesium chelatase accessory protein, rhopx-e6vjl6Rhodopseudomonas palustris (strain DX-1). Magnesium chelatase accessory protein, rhop5-q07kc8Rhodopseudomonas palustris (strain BisA53). Alpha/beta hydrolase fold, rhop5-q07s18Rhodopseudomonas palustris (strain BisA53). Alpha/beta hydrolase fold, rhops-q132k1Rhodopseudomonas palustris (strain BisB5). Alpha/beta hydrolase fold, rhops-q13e72Rhodopseudomonas palustris (strain BisB5). Alpha/beta hydrolase fold.
Monoglyceridelipase_lysophospholip : rhop2-q2ire3Rhodopseudomonas palustris (strain HaA2) alpha/beta hydrolase, rhop2-q2iyz2Rhodopseudomonas palustris (strain HaA2) alpha/beta hydrolase precursor, rhop5-q07hp8Rhodopseudomonas palustris (strain BisA53) alpha/beta hydrolase precursor, rhop5-q07tu0Rhodopseudomonas palustris (strain BisA53) Alpha/beta hydrolase fold, rhopa-q6nbe0Rhodopseudomonas palustris (and strains DX-1; TIE-1) putative lysophospholipase l2, rhopb-q21ba1Rhodopseudomonas palustris (strain BisB18) alpha/beta hydrolase fold, rhops-q13ct0Rhodopseudomonas palustris (strain BisB5) Alpha/beta hydrolase fold.
NLS3-Tex30 : rhopb-q210z9Rhodopseudomonas palustris (strain BisB18) Putative uncharacterized protein, rhopt-b3qgt8Rhodopseudomonas palustris (strain TIE-1) Putative uncharacterized protein.
PAF-Acetylhydrolase : rhopa-q6n4k0Rhodopseudomonas palustris hypothetical protein precursor.
PGAP1 : rhop5-q07nt1Rhodopseudomonas palustris (strain BisA53) Putative uncharacterized protein, rhopa-q6n3c2Rhodopseudomonas palustris hypothetical protein, rhopb-q218h0Rhodopseudomonas palustris (strain BisB18) hypothetical protein.
PhaC_cen_dom : rhop2-q2j0d2Rhodopseudomonas palustris (strain HaA2) poly-beta-hydroxybutyrate synthase, rhopa-q6n209Rhodopseudomonas palustris putative poly-beta-hydroxyalkanoate synthase, rhopb-q20z62Rhodopseudomonas palustris (strain BisB18) poly-beta-hydroxybutyrate polymerase-like.
PHA_synth_I : rhop2-q2ivt9Rhodopseudomonas palustris (strain HaA2) poly(r)-hydroxyalkanoic acid synthase, class I, rhopa-q6n6w3Rhodopseudomonas palustris poly-beta-hydroxybutyrate synthase, rhopb-q213r9Rhodopseudomonas palustris (strain BisB18) poly(r)-hydroxyalkanoic acid synthase, class i.
PHB_depolymerase_PhaZ : rhop2-q2j435Rhodopseudomonas palustris (strain HaA2) polyhydroxyalkanoate depolymerase, intracellular, rhopa-q6nc97Rhodopseudomonas palustris putative intracellular phb depolymerase, rhopb-q21cf5Rhodopseudomonas palustris (strain BisB18) polyhydroxyalkanoate depolymerase, intracellular.
Proline_iminopeptidase : rhop2-q2iyv8Rhodopseudomonas palustris (strain HaA2) proline iminopeptidase (pip) (prolyl aminopeptidase) (pap), rhop5-q07k99Rhodopseudomonas palustris (strain BisA53) Proline iminopeptidase, rhopa-q6n3r3Rhodopseudomonas palustris (and strain TIE-1) putative prolyl aminopeptidase (EC 3.4.11.5), rhopb-q210i3Rhodopseudomonas palustris (strain BisB18) proline iminopeptidase (EC 3.4.11.5), rhops-q133p3Rhodopseudomonas palustris (strain BisB5) Proline iminopeptidase, rhopx-e6vku6Rhodopseudomonas palustris (strain DX-1). Proline iminopeptidase.
S9N_PPCE_Peptidase_S9 : rhopb-q218p9Rhodopseudomonas palustris (strain BisB18) peptidase s9, prolyl oligopeptidase active site region.
S9N_PREPL_Peptidase_S9 : rhop2-q2it08Rhodopseudomonas palustris (strain HaA2) oligopeptidase b (EC 3.4.21.83), rhopa-q6n9h9Rhodopseudomonas palustris putative aminopeptidase, rhopb-q219p2Rhodopseudomonas palustris (strain BisB18) oligopeptidase b (EC 3.4.21.83).
Thioesterase : rhopb-q211m6Rhodopseudomonas palustris (strain BisB18) amino acid adenylation, rhopb-q211n0Rhodopseudomonas palustris (strain BisB18) thioesterase, rhopb-q212v8.1Rhodopseudomonas palustris (strain BisB18) thioesterase, rhopb-q212v8.2Rhodopseudomonas palustris (strain BisB18) thioesterase, rhopb-q212v9Rhodopseudomonas palustris (strain BisB18) amino acid adenylation, rhopb-q217l7Rhodopseudomonas palustris (strain BisB18) thioesterase.
UCP037442 : rhop5-q07q50Rhodopseudomonas palustris (strain BisA53) Putative uncharacterized protein, rhopb-q216q3Rhodopseudomonas palustris (strain BisB18) Putative uncharacterized protein

Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data

Molecular evidence		Database
No mutation 1 structure: 4PSU: Crystal structure of alpha/beta hydrolase RPA1511 from Rhodopseudomonas palustris CGA009 No kinetic 1 substrate: Polylactic-acid No inhibitor		2 Genbank : BX572597, CP001096 2 UniProt : Q6N9M9, B3Q792 1 Structure : 4PSU 2 UniProt : Q6N9M9, B3Q792 2 Interpro : Q6N9M9, B3Q792 2 Pfam : Q6N9M9, B3Q792 2 PIRSF : Q6N9M9, B3Q792 2 SUPERFAM : Q6N9M9, B3Q792

Sequence

Peptide

Graphical view for this peptide sequence: rhopa-q6n9m9
Colored MSA for Mg-chelatase_BchO (raw)
MSDLVWSRDGLDWPHREASRFIEAGGFRWHVQRMGSPAAPAILLIHGTGA ASHSWRGLAPLLSRHYHVVAPDLPGHGFTQTPRGHRMSLPGMASDLAALL RVLQVAPQLVVGHSAGAAILARMCLDGSIDPKILFSLNGAFLPYGGPAAS FFSPLAKMLVMNPFVPSLFAWQAGHRGAVERLIGNTGSTIDPAGIKLYGK LVSSPNHVAAALRMMANWDLEPLLKALPNLKPLLVLVAAEGDRAIPPSVA VKVREILPKAVIERIPALGHLAHEERPALIAALIERYAEKLENIE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MSDLVWSRDGLDWPHREASRFIEAGGFRWHVQRMGSPAAPAILLIHGTGA
ASHSWRGLAPLLSRHYHVVAPDLPGHGFTQTPRGHRMSLPGMASDLAALL
RVLQVAPQLVVGHSAGAAILARMCLDGSIDPKILFSLNGAFLPYGGPAAS
FFSPLAKMLVMNPFVPSLFAWQAGHRGAVERLIGNTGSTIDPAGIKLYGK
LVSSPNHVAAALRMMANWDLEPLLKALPNLKPLLVLVAAEGDRAIPPSVA
VKVREILPKAVIERIPALGHLAHEERPALIAALIERYAEKLENIE

References

Title:

Hajighasemi M, Nocek BP, Tchigvintsev A, Brown G, Flick R, Xu X, Cui H, Hai T, Joachimiak A and Yakunin AF <3 more author(s)>

Ref:

PubMed

ESTHER: Hajighasemi_2016_Biomacromolecules_17_2027
PubMedSearch: Hajighasemi 2016 Biomacromolecules 17 2027
PubMedID: 27087107
Gene_locus related to this paper: marav-a1u5n0, rhopa-q6n9m9, alcbs-q0vlq1

Abstract

Polylactic acid (PLA) is a biodegradable polyester derived from renewable resources, which is a leading candidate for the replacement of traditional petroleum-based polymers. Since the global production of PLA is quickly growing, there is an urgent need for the development of efficient recycling technologies, which will produce lactic acid instead of CO2 as the final product. After screening 90 purified microbial alpha/beta-hydrolases, we identified hydrolytic activity against emulsified PLA in two uncharacterized proteins, ABO2449 from Alcanivorax borkumensis and RPA1511 from Rhodopseudomonas palustris. Both enzymes were also active against emulsified polycaprolactone and other polyesters as well as against soluble alpha-naphthyl and p-nitrophenyl monoesters. In addition, both ABO2449 and RPA1511 catalyzed complete or extensive hydrolysis of solid PLA with the production of lactic acid monomers, dimers, and larger oligomers as products. The crystal structure of RPA1511 was determined at 2.2 A resolution and revealed a classical alpha/beta-hydrolase fold with a wide-open active site containing a molecule of polyethylene glycol bound near the catalytic triad Ser114-His270-Asp242. Site-directed mutagenesis of both proteins demonstrated that the catalytic triad residues are important for the hydrolysis of both monoester and polyester substrates. We also identified several residues in RPA1511 (Gln172, Leu212, Met215, Trp218, and Leu220) and ABO2449 (Phe38 and Leu152), which were not essential for activity against soluble monoesters but were found to be critical for the hydrolysis of PLA. Our results indicate that microbial carboxyl esterases can efficiently hydrolyze various polyesters making them attractive biocatalysts for plastics depolymerization and recycling.

Title:

Larimer FW, Chain P, Hauser L, Lamerdin J, Malfatti S, Do L, Land ML, Pelletier DA, Beatty JT and Harwood CS <9 more author(s)>

Ref:

PubMed

Other Papers

Send your questions or comments to :Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.

For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page

webmaster

Acknowledgements and disclaimer