Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: rhopa-q6nam1

Rhodopseudomonas palustris (and strains BisB5; TIE-1) RPA1163 possible epoxide hydrolase

Relationship
Family|Haloacetate_dehalogenase
Block| X
Position in NCBI Life Tree|Rhodopseudomonas palustris
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhizobiales: N E > Bradyrhizobiaceae: N E > Rhodopseudomonas: N E > Rhodopseudomonas palustris: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
49 structures (e.g. : 3R3U, 3R3V, 3R3W... more)
No kinetic





2 substrates: Bromoacetate, Chloroacetate
1 inhbitor:
Glycolate
3 Genbank : BX572596, AAKZ01000012, CP001096
2 UniProt : Q6NAM1, B3QIH0
>3 Structure links 46 more: 6QHT, 5NYV, 6QHQ
2 UniProt : Q6NAM1, B3QIH0
2 Interpro : Q6NAM1, B3QIH0
2 Prodom : Q6NAM1, B3QIH0
2 Pfam : Q6NAM1, B3QIH0
2 PIRSF : Q6NAM1, B3QIH0
2 SUPERFAM : Q6NAM1, B3QIH0
Sequence
Graphical view for this peptide sequence: rhopa-q6nam1
Colored MSA for Haloacetate_dehalogenase (raw)
MPDLADLFPGFGSEWINTSSGRIFARVGGDGPPLLLLHGFPQTHVMWHRV
APKLAERFKVIVADLPGYGWSDMPESDEQHTPYTKRAMAKQLIEAMEQLG
HVHFALAGHDRGARVSYRLALDSPGRLSKLAVLDILPTYEYWQRMNRAYA
LKIYHWSFLAQPAPLPENLLGGDPDFYVKAKLASWTRAGDLSAFDPRAVE
HYRIAFADPMRRHVMCEDYRAGAYADFEHDKIDVEAGNKIPVPMLALWGA
SGIAQSAATPLDVWRKWASDVQGAPIESGHFLPEEAPDQTAEALVRFFSA
AP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPDLADLFPGFGSEWINTSSGRIFARVGGDGPPLLLLHGFPQTHVMWHRV
APKLAERFKVIVADLPGYGWSDMPESDEQHTPYTKRAMAKQLIEAMEQLG
HVHFALAGHDRGARVSYRLALDSPGRLSKLAVLDILPTYEYWQRMNRAYA
LKIYHWSFLAQPAPLPENLLGGDPDFYVKAKLASWTRAGDLSAFDPRAVE
HYRIAFADPMRRHVMCEDYRAGAYADFEHDKIDVEAGNKIPVPMLALWGA
SGIAQSAATPLDVWRKWASDVQGAPIESGHFLPEEAPDQTAEALVRFFSA
AP


References
7 more
    Title: Serial femtosecond and serial synchrotron crystallography can yield data of equivalent quality: A systematic comparison
    Mehrabi P, Bucker R, Bourenkov G, Ginn HM, von Stetten D, Muller-Werkmeister HM, Kuo A, Morizumi T, Eger BT and Miller RJD <15 more author(s)>
    Ref: Sci Adv, 7:, 2021 : PubMed

            

    Title: Time-resolved crystallography reveals allosteric communication aligned with molecular breathing
    Mehrabi P, Schulz EC, Dsouza R, Muller-Werkmeister HM, Tellkamp F, Miller RJD, Pai EF
    Ref: Science, 365:1167, 2019 : PubMed

            

    Title: Substrate-Based Allosteric Regulation of a Homodimeric Enzyme
    Mehrabi P, Di Pietrantonio C, Kim TH, Sljoka A, Taverner K, Ing C, Kruglyak N, Pomes R, Pai EF, Prosser RS
    Ref: Journal of the American Chemical Society, 141:11540, 2019 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer