Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: rhopr-r4g875

Rhodnius prolixus (Triatomid bug); Rhodnius neglectus, Uncharacterized protein

Comment
Other strains: Rhodnius prolixus (Triatomid bug); Rhodnius neglectus


Relationship
Family|Carb_B_Arthropoda
Block| C
Position in NCBI Life Tree|Rhodnius prolixus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Paraneoptera: N E > Hemiptera: N E > Prosorrhyncha: N E > Heteroptera: N E > Euheteroptera: N E > Neoheteroptera: N E > Panheteroptera: N E > Cimicomorpha: N E > Reduvioidea: N E > Reduviidae: N E > Triatominae: N E > Rhodnius: N E > Rhodnius prolixus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : GAHY01001462
1 UniProt : R4G875
2 UniProt : R4G875, A0A0P4VPU3
2 Interpro : R4G875, A0A0P4VPU3
2 Prodom : R4G875, A0A0P4VPU3
2 Pfam : R4G875, A0A0P4VPU3
2 PIRSF : R4G875, A0A0P4VPU3
2 SUPERFAM : R4G875, A0A0P4VPU3
Sequence
Graphical view for this peptide sequence: rhopr-r4g875
Colored MSA for Carb_B_Arthropoda (raw)
MLLQMFKFILFLLLSISLCLAVTVRTKLGEVRGDERKSRDGKTYYAFTSI
PYAKPPVGKLRLKNPTRAEPWKEVLDATKEMPLCLQVPLYHHFLRNETWG
QEDCLYLSVYTPDINPKEKLAVLVQTHGGGFRCGNAGLKDNADYLMDGNV
VLVNIHYRLGTLGFLSTEDSIIPGNFGLKDQSMGLHWVKENIKAFGGDDE
KITVFGESAGGASAHYHLMSPLSKSILKGAISQSGVVNRLWAICEPGKAR
NQAERLAEIVGCGGKKDKELLECLQNTCPKRLIRAEIEFLYWDFDPPVVF
CPVEEPFAEGAFLPFDALKQETTLPWLTGIVSNEGAFKVASLKSQGDSSV
QQFIDNLDDYLFRLLNLDESCPKAKETTRLVKEKYFPEPVTLQSALSGHE
ALFSDAYIVYPMGDALRRHKGPVYQYLYDYRGGTSYTDTFGDLGDLGVCH
ADDLFIMFNFKEQFPKTKPDEEQVSRTMVRLWTNFAKYQKPTTEEDEVEW
PRYDSLGRYMHITSGLQVKRHLKADVIDWWFKLPAFSSYEALKTEL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLLQMFKFILFLLLSISLCLAVTVRTKLGEVRGDERKSRDGKTYYAFTSI
PYAKPPVGKLRLKNPTRAEPWKEVLDATKEMPLCLQVPLYHHFLRNETWG
QEDCLYLSVYTPDINPKEKLAVLVQTHGGGFRCGNAGLKDNADYLMDGNV
VLVNIHYRLGTLGFLSTEDSIIPGNFGLKDQSMGLHWVKENIKAFGGDDE
KITVFGESAGGASAHYHLMSPLSKSILKGAISQSGVVNRLWAICEPGKAR
NQAERLAEIVGCGGKKDKELLECLQNTCPKRLIRAEIEFLYWDFDPPVVF
CPVEEPFAEGAFLPFDALKQETTLPWLTGIVSNEGAFKVASLKSQGDSSV
QQFIDNLDDYLFRLLNLDESCPKAKETTRLVKEKYFPEPVTLQSALSGHE
ALFSDAYIVYPMGDALRRHKGPVYQYLYDYRGGTSYTDTFGDLGDLGVCH
ADDLFIMFNFKEQFPKTKPDEEQVSRTMVRLWTNFAKYQKPTTEEDEVEW
PRYDSLGRYMHITSGLQVKRHLKADVIDWWFKLPAFSSYEALKTEL



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer