Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: rhosm-cocE

Rhodococcus sp. (strain MB1 Bresler) cocaine esterase (EC 3.1.1.-)

Relationship
Family|Cocaine_esterase
Block| X
Position in NCBI Life Tree|Rhodococcus sp.
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Nocardiaceae: N E > Rhodococcus: N E > Rhodococcus sp.: N E


Molecular evidence
Database
No mutation
15 structures (e.g. : 1JU3, 1JU4, 1L7Q... more)
No kinetic





1 substrate:
Benzoylecgonine
3 inhibitors: Benzoic-acid, DTT-adduct, Phenylboronic-acid
1 Genbank : AF173165
1 UniProt : Q9L9D7
>3 Structure links 12 more: 1JU3, 1JU4, 1L7R
1 UniProt : Q9L9D7
1 Interpro : Q9L9D7
1 Prodom : Q9L9D7
1 Pfam : Q9L9D7
1 PIRSF : Q9L9D7
1 SUPERFAM : Q9L9D7
Sequence
Graphical view for this peptide sequence: rhosm-cocE
Colored MSA for Cocaine_esterase (raw)
MVDGNYSVASNVMVPMRDGVRLAVDLYRPDADGPVPVLLVRNPYDKFDVF
AWSTQSTNWLEFVRDGYAVVIQDTRGLFASEGEFVPHVDDEADAEDTLSW
ILEQAWCDGNVGMFGVSYLGVTQWQAAVSGVGGLKAIAPSMASADLYRAP
WYGPGGALSVEALLGWSALIGTGLITSRSDARPEDAADFVQLAAILNDVA
GAASVTPLAEQPLLGRLIPWVIDQVVDHPDNDESWQSISLFERLGGLATP
ALITAGWYDGFVGESLRTFVAVKDNADARLVVGPWSHSNLTGRNADRKFG
IAATYPIQEATTMHKAFFDRHLRGETDALAGVPKVRLFVMGIDEWRDETD
WPLPDTAYTPFYLGGSGAANTSTGGGTLSTSISGTESADTYLYDPADPVP
SLGGTLLFHNGDNGPADQRPIHDRDDVLCYSTEVLTDPVEVTGTVSARLF
VSSSAVDTDFTAKLVDVFPDGRAIALCDGIVRMRYRETLVNPTLIEAGEI
YEVAIDMLATSNVFLPGHRIMVQVSSSNFPKYDRNSNTGGVIAREQLEEM
CTAVNRIHRGPEHPSHIVLPIIKR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVDGNYSVASNVMVPMRDGVRLAVDLYRPDADGPVPVLLVRNPYDKFDVF
AWSTQSTNWLEFVRDGYAVVIQDTRGLFASEGEFVPHVDDEADAEDTLSW
ILEQAWCDGNVGMFGVSYLGVTQWQAAVSGVGGLKAIAPSMASADLYRAP
WYGPGGALSVEALLGWSALIGTGLITSRSDARPEDAADFVQLAAILNDVA
GAASVTPLAEQPLLGRLIPWVIDQVVDHPDNDESWQSISLFERLGGLATP
ALITAGWYDGFVGESLRTFVAVKDNADARLVVGPWSHSNLTGRNADRKFG
IAATYPIQEATTMHKAFFDRHLRGETDALAGVPKVRLFVMGIDEWRDETD
WPLPDTAYTPFYLGGSGAANTSTGGGTLSTSISGTESADTYLYDPADPVP
SLGGTLLFHNGDNGPADQRPIHDRDDVLCYSTEVLTDPVEVTGTVSARLF
VSSSAVDTDFTAKLVDVFPDGRAIALCDGIVRMRYRETLVNPTLIEAGEI
YEVAIDMLATSNVFLPGHRIMVQVSSSNFPKYDRNSNTGGVIAREQLEEM
CTAVNRIHRGPEHPSHIVLPIIKR


References
5 more
    Title: Computational design of cephradine synthase in a new scaffold identified from structural databases
    Huang X, Xue J, Zhu Y
    Ref: Chem Commun (Camb), 53:7604, 2017 : PubMed

            

    Title: Crystal structure of a bacterial cocaine esterase
    Larsen NA, Turner JM, Stevens J, Rosser SJ, Basran A, Lerner RA, Bruce NC, Wilson IA
    Ref: Nat Struct Biol, 9:17, 2002 : PubMed

            

    Title: Gene cloning and nucleotide sequencing and properties of a cocaine esterase from Rhodococcus sp. strain MB1
    Bresler MM, Rosser SJ, Basran A, Bruce NC
    Ref: Applied Environmental Microbiology, 66:904, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer