Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: rhoso-halo1

Rhodococcus rhodochrous (Pseudomonas pavonaceae), Rhodococcus sp., Mycobacterium sp haloalkane dehalogenase (EC 3.8.1.5) DhaA HaloTag

Comment
Other strains: Rhodococcus rhodochrous (NCIMB 13064); Rhodococcus sp. (strain TDTM0003); Mycobacterium sp (strain GP1); Pseudomonas pavonaceae) encoded on plasmid. The HaloTag is Rhodococcus rhodochrous haloalkane dehalogenase, which has a genetically modified active site, which specifically binds the reactive chloroalkane linker and has an increased rate of ligand binding. HaloTagged fusion proteins can be expressed easily and allow enzymatic assays, cellular imaging, protein arrays, determination of sub-cellular localization.(HaloTag L47V, S58T, D78G, Y87F, L88M, C128F, A155T, E160K, A167V, A172T, K175M, C176G, K195N, A224E, N227D, E257K, T264A, H272N, Y273L) Some of the most recent structures of proteins with halotag are not included in ESTHER as the tag is only a tool and not analyzed as an alpha/beta hydolase: see for example 7KTS 7KTR haloalkane dehalogenase Pseudomonas pavonaceae differs only with two aa of Rhodococcus haloalkane dehalogenase. Also identical to Mycobacterium sp (same paper)


Relationship
Family|Haloalkane_dehalogenase-HLD2
Block| X
Position in NCBI Life Tree|Rhodococcus rhodochrous
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Nocardiaceae: N E > Rhodococcus: N E > Rhodococcus rhodochrous: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
51 structures (e.g. : 1BN6, 1BN7, 1CQW... more)
No kinetic





29 substrates (e.g. : (Bromomethyl)cylcohexane, 1,2,3-Tribromopropane, 1,2,3-trichloropropane... more)
14 inhibitors (e.g. : Benzoic-acid, Chloroalkane-carbopyronine-fluorophore, Chloroalkane-tetramethylrhodamine-fluorophore... more)
>3 Genbank links 1 more: AJ250371, AJ012627, AF060871
>3 UniProt links 2 more: P0A3G2, P0A3G3, P0A3G4
2 Ncbi-nid : 6689028, 3860530
2 Ncbi-pid : 6689030, 3860531
>3 Structure links 48 more: 1BN6, 1BN7, 1CQW
>3 UniProt links 2 more: P0A3G2, P0A3G3, P0A3G4
>3 Interpro links 2 more: P0A3G2, P0A3G3, P0A3G4
>3 Prodom links 2 more: P0A3G2, P0A3G3, P0A3G4
>3 Pfam links 2 more: P0A3G2, P0A3G3, P0A3G4
>3 PIRSF links 2 more: P0A3G2, P0A3G3, P0A3G4
>3 SUPERFAM links 2 more: P0A3G2, P0A3G3, P0A3G4
Sequence
Graphical view for this peptide sequence: rhoso-halo1
Colored MSA for Haloalkane_dehalogenase-HLD2 (raw)
MSEIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRN
IIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEV
VLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWPEFARETFQ
AFRTADVGRELIIDQNAFIEGALPKCVVRPLTEVEMDHYREPFLKPVDRE
PLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPA
EAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPAL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSEIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRN
IIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEV
VLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWPEFARETFQ
AFRTADVGRELIIDQNAFIEGALPKCVVRPLTEVEMDHYREPFLKPVDRE
PLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPA
EAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPAL


References
24 more
    Title: The HaloTag as a general scaffold for far-red tunable chemigenetic indicators
    Deo C, Abdelfattah AS, Bhargava HK, Berro AJ, Falco N, Farrants H, Moeyaert B, Chupanova M, Lavis LD, Schreiter ER
    Ref: Nat Chemical Biology, 17:718, 2021 : PubMed

            

    Title: Stabilization of Haloalkane Dehalogenase Structure by Interfacial Interaction with Ionic Liquids
    Shaposhnikova A, Kuty M, Chaloupkova R, Damborsky J, Smatanova IK, Minofar B, Prudnikova T
    Ref: Crystals, 11:1052, 2021 : PubMed

            

    Title: Kinetic and Structural Characterization of the Self-Labeling Protein Tags HaloTag7, SNAP-tag, and CLIP-tag
    Wilhelm J, Kuhn S, Tarnawski M, Gotthard G, Tunnermann J, Tanzer T, Karpenko J, Mertes N, Xue L and Johnsson K <3 more author(s)>
    Ref: Biochemistry, 60:2560, 2021 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer