(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Bacteria: NE > Proteobacteria: NE > Betaproteobacteria: NE > Burkholderiales: NE > unclassified Burkholderiales: NE > Burkholderiales Genera incertae sedis: NE > Rubrivivax: NE > Rubrivivax gelatinosus: NE
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) Rubrivivax gelatinosus IL144: N, E.
Rubrivivax benzoatilyticus JA2: N, E.
Rubrivivax benzoatilyticus JA2 = ATCC BAA-35: N, E.
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MSGAPTHLLYLHGFRSSPQSAKARRVGAWLAEHRPELKFWSPQLPPSPRA AVAMLLEGTADWPATSVVVGSSLGGFYATAVAEARGWTAGVLNPAVDPAR DLAAYIGENKQFHKPEESFFFLPEYVDELRALRPPAITRPERYFAVVATG DELLDWREMHARYAGATIRLVEGSDHALSDFDEHLPHLLRYLRLCD
Herein we report the draft genome sequence of a phototrophic bacterium, Rubrivivax benzoatilyticus strain JA2(T), which apparently is the first genome sequence report of a phototrophic member belonging to the class Betaproteobacteria. The unique feature of this strain is its capability to synthesize carotenoids through both spirilloxanthin and spheroidenone pathways. Strain JA2(T) produces several novel secondary metabolites, and the genome insights help in understanding the unique machinery that the strain adapted.
