Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: sacen-a4f6m6

Saccharopolyspora erythraea (strain NRRL 23338) Esterase

Relationship
Family|HNLyase_Bact
Block| X
Position in NCBI Life Tree|Saccharopolyspora erythraea
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Pseudonocardiales: N E > Pseudonocardiaceae: N E > Saccharopolyspora: N E > Saccharopolyspora erythraea: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AM420293
1 UniProt : A4F6M6
1 UniProt : A4F6M6
1 Interpro : A4F6M6
1 Prodom : A4F6M6
1 Pfam : A4F6M6
1 PIRSF : A4F6M6
1 SUPERFAM : A4F6M6
Sequence
Graphical view for this peptide sequence: sacen-a4f6m6
Colored MSA for HNLyase_Bact (raw)
MSHTFVLVHGSNCNSFTWAPMQRELALLGHRSLAVDLPGHGFAAGWHPSY
QAPQDPAALASAPSGQAGRTVAECVEHVVEVVRRAAAHGPVTLVGHSRGG
LTLTGVGNAVPELVDRLVYVSAWCCVDSTVAEYVASPENADSVLGEAAGV
MVGDIAALGAIRMNWRTADAGLLATLKTAMLADGTDEEFLAFLNTLEPDE
SLDAGGIGVQADAATWGRVPRSYVRLTRDRSLPVALQDRFIAEADALTPG
NPFDVHSVEGSHVGFLVHPQEVAGILAELAA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSHTFVLVHGSNCNSFTWAPMQRELALLGHRSLAVDLPGHGFAAGWHPSY
QAPQDPAALASAPSGQAGRTVAECVEHVVEVVRRAAAHGPVTLVGHSRGG
LTLTGVGNAVPELVDRLVYVSAWCCVDSTVAEYVASPENADSVLGEAAGV
MVGDIAALGAIRMNWRTADAGLLATLKTAMLADGTDEEFLAFLNTLEPDE
SLDAGGIGVQADAATWGRVPRSYVRLTRDRSLPVALQDRFIAEADALTPG
NPFDVHSVEGSHVGFLVHPQEVAGILAELAA


Reference
    Title: Complete genome sequence of the erythromycin-producing bacterium Saccharopolyspora erythraea NRRL23338
    Oliynyk M, Samborskyy M, Lester JB, Mironenko T, Scott N, Dickens S, Haydock SF, Leadlay PF
    Ref: Nat Biotechnol, 25:447, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer