Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: sacer-Q9JN61

Saccharopolyspora erythraea (Streptomyces erythraeus) erythomycin a biosynthesis thioesterase (EC 3.1.-.-.) 26.5 kda Ery-ORF5 TEII orf3?

Comment
Other strains: Saccharopolyspora erythraea (Streptomyces erythraeus) (strain NRRL 23338)


Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Saccharopolyspora erythraea
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Pseudonocardiales: N E > Pseudonocardiaceae: N E > Saccharopolyspora: N E > Saccharopolyspora erythraea: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : M54983, X60379
3 UniProt : Q9JN61, A4F7P6, Q00442
3 UniProt : Q9JN61, A4F7P6, Q00442
3 Interpro : Q9JN61, A4F7P6, Q00442
3 Pfam : Q9JN61, A4F7P6, Q00442
3 PIRSF : Q9JN61, A4F7P6, Q00442
3 SUPERFAM : Q9JN61, A4F7P6, Q00442
Sequence
Graphical view for this peptide sequence: sacer-Q9JN61
Colored MSA for Thioesterase (raw)
MSTWLRRFGPPVEHRARLVCFPHAGAAADSYLDLARALAPEIDVHAVQYP
GRQDRRDEEPLGTAGEIADEVAAVLRASGGDGPFALFGHSMGALIAYETA
RRLEREPGGGPLRLFVSGQTAPRVHERRTDLPGDDGLVDELRRLGTSEAA
LADEALLAMSLPVLRADYRVLRSYAWADGPPLRAGITALCGDADPLTATG
DAERWLQHSVIPGRTRTFPGGHFYLGEQVTEVAGAVRRDLLRAGLAG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSTWLRRFGPPVEHRARLVCFPHAGAAADSYLDLARALAPEIDVHAVQYP
GRQDRRDEEPLGTAGEIADEVAAVLRASGGDGPFALFGHSMGALIAYETA
RRLEREPGGGPLRLFVSGQTAPRVHERRTDLPGDDGLVDELRRLGTSEAA
LADEALLAMSLPVLRADYRVLRSYAWADGPPLRAGITALCGDADPLTATG
DAERWLQHSVIPGRTRTFPGGHFYLGEQVTEVAGAVRRDLLRAGLAG


References
1 more
    Title: Complete genome sequence of the erythromycin-producing bacterium Saccharopolyspora erythraea NRRL23338
    Oliynyk M, Samborskyy M, Lester JB, Mironenko T, Scott N, Dickens S, Haydock SF, Leadlay PF
    Ref: Nat Biotechnol, 25:447, 2007 : PubMed

            

    Title: Cloning and sequence analysis of genes involved in erythromycin biosynthesis in Saccharopolyspora erythraea: sequence similarities between EryG and a family of S-adenosylmethionine-dependent methyltransferases.
    Haydock SF, Dowson JA, Dhillon N, Roberts GA, Cortes J, Leadlay PF
    Ref: Molecular & General Genetics, 230:120, 1991 : PubMed

            

    Title: An erythromycin derivative produced by targeted gene disruption in Saccharopolyspora erythraea.
    Weber JM, Leung JO, Swanson SJ, Idler KB, McAlpine JB
    Ref: Science, 252:114, 1991 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer