sacer-ery3

 
Saccharopolyspora erythraea (Streptomyces erythraeus) deoxyerythronolide b synthase III (debs 3) Thioesterase domain

Relationship
Block X
Saccharopolyspora erythraea position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Pseudonocardiales: N E > Pseudonocardiaceae: N E > Saccharopolyspora: N E > Saccharopolyspora erythraea: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
5 structures (e.g. : 1KEZ, 6MLK, 5D3K... more)
No kinetic


Inhibitor: Diphenyl-allylphosphonate ,
>3 Genbank links 1 more: AY661566, X56107, M63677
2 UniProt : Q03133, Q5UNP4
>3 Structure links 2 more: 1KEZ, 6MLK, 5D3K
2 UniProtTrembl : Q03133, Q5UNP4
2 Interpro : Q03133, Q5UNP4
2 Prodom : Q03133, Q5UNP4
2 Pfam : Q03133, Q5UNP4
2 PIRSF : Q03133, Q5UNP4
2 SUPERFAM : Q03133, Q5UNP4
2 QuickSwissBlast : Q03133, Q5UNP4
 
Sequence
Graphical view for this peptide sequence: sacer-ery3
Colored MSA for Thioesterase (raw)
SSALRDGYRQAGVSGRVRSYLDLLAGLSDFREHFDGSDGFSLDLVDMADG
PGEVTVICCAGTAAISGPHEFTRLAGALRGIAPVRAVPQPGYEEGEPLPS
SMAAVAAVQADAVIRTQGDKPFVVAGHSAGALMAYALATELLDRGHPPRG
VVLIDVYPPGHQDAMNAWLEELTATLFDRETVRMDDTRLTALGAYDRLTG
QWRPRETGLPTLLVSAGEPMGPWPDDSWKPTWPFEHDTVAVPGDHFTMVQ
EHADAIARHIDAWLGGGNS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

SSALRDGYRQAGVSGRVRSYLDLLAGLSDFREHFDGSDGFSLDLVDMADG
PGEVTVICCAGTAAISGPHEFTRLAGALRGIAPVRAVPQPGYEEGEPLPS
SMAAVAAVQADAVIRTQGDKPFVVAGHSAGALMAYALATELLDRGHPPRG
VVLIDVYPPGHQDAMNAWLEELTATLFDRETVRMDDTRLTALGAYDRLTG
QWRPRETGLPTLLVSAGEPMGPWPDDSWKPTWPFEHDTVAVPGDHFTMVQ
EHADAIARHIDAWLGGGNS

no DNA




References
6 more
    Title: Discovery and Characterization of a Thioesterase-Specific Monoclonal Antibody That Recognizes the 6-Deoxyerythronolide B Synthase
    Li X, Sevillano N, La Greca F, Hsu J, Mathews, II, Matsui T, Craik CS, Khosla C
    Ref: Biochemistry, 57:6201, 2018 : PubMed

            

    Title: Total synthesis of long DNA sequences: synthesis of a contiguous 32-kb polyketide synthase gene cluster
    Kodumal SJ, Patel KG, Reid R, Menzella HG, Welch M, Santi DV
    Ref: Proc Natl Acad Sci U S A, 101:15573, 2004 : PubMed

            

    Title: An unusually large multifunctional polypeptide in the erythromycin-producing polyketide synthase of Saccharopolyspora erythraea
    Cortes J, Haydock SF, Roberts GA, Bevitt DJ, Leadlay PF
    Ref: Nature, 348:176, 1990 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer