Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: sack1-j5ri36

Saccharomyces kudriavzevii (strain ATCC MYA-4449 / AS 2.2408 / CBS 8840 / NBRC 1802 / NCYC 2889) (Yeast). HDA1-like protein

Relationship
Family|Arb2_domain
Block| X
Position in NCBI Life Tree|Saccharomyces kudriavzevii
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Saccharomyces: N E > Saccharomyces kudriavzevii: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AACI03001979
1 UniProt : J5RI36
1 UniProt : J5RI36
1 Interpro : J5RI36
1 Prodom : J5RI36
1 Pfam : J5RI36
1 PIRSF : J5RI36
1 SUPERFAM : J5RI36
Sequence
Graphical view for this peptide sequence: sack1-j5ri36
Colored MSA for Arb2_domain (raw)
PLQKAIRQQQLQYLSNEFSFVTLPLINMGLPDNTALCTPNVFESNALLVV
VHDTSDVWAKRNVISGTIDLSSSVIIDNCIDFIKWGLDRKYGIIDVNIPL
TLFEADNYSGMITSQEVLIYLWDNYIKYFPNVAKIAFIGIGDSHSGIVHL
LGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQ
CWKENESRKPRKKFGRVLRCDTDGLSNTIEERFEEATDFILDSFEEWSDD
E
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

PLQKAIRQQQLQYLSNEFSFVTLPLINMGLPDNTALCTPNVFESNALLVV
VHDTSDVWAKRNVISGTIDLSSSVIIDNCIDFIKWGLDRKYGIIDVNIPL
TLFEADNYSGMITSQEVLIYLWDNYIKYFPNVAKIAFIGIGDSHSGIVHL
LGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQ
CWKENESRKPRKKFGRVLRCDTDGLSNTIEERFEEATDFILDSFEEWSDD
E


References
    Title: The Awesome Power of Yeast Evolutionary Genetics: New Genome Sequences and Strain Resources for the Saccharomyces sensu stricto Genus
    Scannell DR, Zill OA, Rokas A, Payen C, Dunham MJ, Eisen MB, Rine J, Johnston M, Hittinger CT
    Ref: G3 (Bethesda), 1:11, 2011 : PubMed

            

    Title: Finding functional features in Saccharomyces genomes by phylogenetic footprinting
    Cliften P, Sudarsanam P, Desikan A, Fulton L, Fulton B, Majors J, Waterston R, Cohen BA, Johnston M
    Ref: Science, 301:71, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer