Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: salsn-a0a4d9bp73

Salvia splendens (Scarlet sage). Abhydrolase_3 domain-containing protein

Relationship
Family|Plant_carboxylesterase
Block| H
Position in NCBI Life Tree|Salvia splendens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > asterids: N E > lamiids: N E > Lamiales: N E > Lamiaceae: N E > Nepetoideae: N E > Mentheae: N E > Salvia: N E > Calosphace: N E > core Calosphace: N E > Salvia splendens: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : PNBA01000013
1 UniProt : A0A4D9BP73
1 UniProt : A0A4D9BP73
1 Interpro : A0A4D9BP73
1 Pfam : A0A4D9BP73
1 PIRSF : A0A4D9BP73
1 SUPERFAM : A0A4D9BP73
Sequence
Graphical view for this peptide sequence: salsn-a0a4d9bp73
Colored MSA for Plant_carboxylesterase (raw)
MAAITMEPNLSSHQMRGKASQHKLQVVEEIEGIIKVYNNGHVERPEIMPS
VGCSLAPDLGVTCRDATIDTYTNLWARIYAPTAANKLPLLLYFHGGGFCV
GAASWACYHEFLANLAARASCAVVSVNYRLAPEHPLPAAYDDGVKAAIWA
KQQEFSGGSEWWAGKCDFSRIFLAGDSAGANIAYNVGLRVANSIGFGAIK
GLVMIQPFFGGEARTRSEVCAAQPPRSALTLAASDAYWRMALPAGADRDH
PWCNAASSAELRRAGVAVMVCVAEADILRDRNLEFSGGLAREGVRVEQVV
SKGVGHAFQILNKSHLAKTRLHELFSHVQHFVGR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAAITMEPNLSSHQMRGKASQHKLQVVEEIEGIIKVYNNGHVERPEIMPS
VGCSLAPDLGVTCRDATIDTYTNLWARIYAPTAANKLPLLLYFHGGGFCV
GAASWACYHEFLANLAARASCAVVSVNYRLAPEHPLPAAYDDGVKAAIWA
KQQEFSGGSEWWAGKCDFSRIFLAGDSAGANIAYNVGLRVANSIGFGAIK
GLVMIQPFFGGEARTRSEVCAAQPPRSALTLAASDAYWRMALPAGADRDH
PWCNAASSAELRRAGVAVMVCVAEADILRDRNLEFSGGLAREGVRVEQVV
SKGVGHAFQILNKSHLAKTRLHELFSHVQHFVGR



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer