Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: salty-STM0332

Salmonella typhimurium, Salmonella paratyphi, S. choleraesuis, S. enteritidis, S. enterica, S. agona, S. newport, S. dublin, S. gallinarum, putative hydrolase or acyltransferase

Comment
There are more than 800 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Family|Haloacetate_dehalogenase
Block| X
Position in NCBI Life Tree|Salmonella typhimurium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Enterobacteriaceae: N E > Salmonella: N E > Salmonella enterica: N E > Salmonella enterica subsp. enterica: N E > Salmonella enterica subsp. enterica serovar Typhimurium: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
4NVR: 2.22 Angstrom Resolution Crystal Structure of a Putative Acyltransferase from Salmonella enterica
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: salty-STM0332
Colored MSA for Haloacetate_dehalogenase (raw)
MSTLIECGASPFIPGFALKDVRLENGLTVRVAIGGSGSPLVLLHGHPQNH
TTWRKVAPTLAQNHTVILPDLRGYGDSDKPTSDPAHRTYSKRTMAQDIVM
LMDALGFSRFAFVGHDRGGRVGHRLALDYPDRVTCCTFIDIAPTATMYAL
TDKSFATRYFWWFFLIQPFPLPETMIAHDPAFFLRKHISGQLKIEGATSQ
EAFNEYLRCYQNPEMIHAICEDYRAAATIDLDDDAADTSARIRCPLQLLW
GGLGTVGQLYNVVGTWKEKALNVQGEALPCGHSPQEECPEYFIQKLQSFL
HSVL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSTLIECGASPFIPGFALKDVRLENGLTVRVAIGGSGSPLVLLHGHPQNH
TTWRKVAPTLAQNHTVILPDLRGYGDSDKPTSDPAHRTYSKRTMAQDIVM
LMDALGFSRFAFVGHDRGGRVGHRLALDYPDRVTCCTFIDIAPTATMYAL
TDKSFATRYFWWFFLIQPFPLPETMIAHDPAFFLRKHISGQLKIEGATSQ
EAFNEYLRCYQNPEMIHAICEDYRAAATIDLDDDAADTSARIRCPLQLLW
GGLGTVGQLYNVVGTWKEKALNVQGEALPCGHSPQEECPEYFIQKLQSFL
HSVL


References
3 more
    Title: Short-term signatures of evolutionary change in the Salmonella enterica serovar typhimurium 14028 genome
    Jarvik T, Smillie C, Groisman EA, Ochman H
    Ref: Journal of Bacteriology, 192:560, 2010 : PubMed

            

    Title: The genome sequence of Salmonella enterica serovar Choleraesuis, a highly invasive and resistant zoonotic pathogen
    Chiu CH, Tang P, Chu C, Hu S, Bao Q, Yu J, Chou YY, Wang HS, Lee YS
    Ref: Nucleic Acids Research, 33:1690, 2005 : PubMed

            

    Title: Complete genome sequence of Salmonella enterica serovar Typhimurium LT2
    McClelland M, Sanderson KE, Spieth J, Clifton SW, Latreille P, Courtney L, Porwollik S, Ali J, Dante M and Wilson RK <16 more author(s)>
    Ref: Nature, 413:852, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer