Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: salty-STM2547

Salmonella paratyphi-a, Salmonella typhimurium, Salmonella choleraesuis; Salmonella typhi Putative hydrolase yfhr

Comment
There are more than 800 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Family|ABHD13-BEM46
Block| X
Position in NCBI Life Tree|Salmonella paratyphi-a
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Enterobacteriaceae: N E > Salmonella: N E > Salmonella enterica: N E > Salmonella enterica subsp. enterica: N E > Salmonella enterica subsp. enterica serovar Paratyphi A: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 2 more: AE017220, CP000026, AE008816
3 UniProt : Q8ZN39, Q57LG5, Q8Z4M8
3 UniProt : Q8ZN39, Q57LG5, Q8Z4M8
3 Interpro : Q8ZN39, Q57LG5, Q8Z4M8
3 Prodom : Q8ZN39, Q57LG5, Q8Z4M8
3 Pfam : Q8ZN39, Q57LG5, Q8Z4M8
3 PIRSF : Q8ZN39, Q57LG5, Q8Z4M8
3 SUPERFAM : Q8ZN39, Q57LG5, Q8Z4M8
Sequence
Graphical view for this peptide sequence: salty-STM2547
Colored MSA for ABHD13-BEM46 (raw)
MTLQHTRRIVKSLFILFIIVVCIYLLPRVAINAFYYPDNKVYGPTPAEAE
SITFTAKDGTHLHGWFIPTAFGRPENAVATVIHVHGNAGNMSAHWPLVSW
LPERNVNLFMFDYRGFGESEGTPSQEGLLDDTKSAIDYVRHRADVNPERL
VLLGQSLGGNNVLAAVGHCVGCANMRYADQAGIRAIILDSTFLSYSSIAN
QMIPGSGYLLDDRYSADRNIASVSPIPVLILHGTADHVIPWQDSEKLYAL
AREPKQKIFIPDGDHIDAFSGRYANLYRDAMIKFIQTALSAK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTLQHTRRIVKSLFILFIIVVCIYLLPRVAINAFYYPDNKVYGPTPAEAE
SITFTAKDGTHLHGWFIPTAFGRPENAVATVIHVHGNAGNMSAHWPLVSW
LPERNVNLFMFDYRGFGESEGTPSQEGLLDDTKSAIDYVRHRADVNPERL
VLLGQSLGGNNVLAAVGHCVGCANMRYADQAGIRAIILDSTFLSYSSIAN
QMIPGSGYLLDDRYSADRNIASVSPIPVLILHGTADHVIPWQDSEKLYAL
AREPKQKIFIPDGDHIDAFSGRYANLYRDAMIKFIQTALSAK


References
2 more
    Title: The genome sequence of Salmonella enterica serovar Choleraesuis, a highly invasive and resistant zoonotic pathogen
    Chiu CH, Tang P, Chu C, Hu S, Bao Q, Yu J, Chou YY, Wang HS, Lee YS
    Ref: Nucleic Acids Research, 33:1690, 2005 : PubMed

            

    Title: Comparison of genome degradation in Paratyphi A and Typhi, human-restricted serovars of Salmonella enterica that cause typhoid
    McClelland M, Sanderson KE, Clifton SW, Latreille P, Porwollik S, Sabo A, Meyer R, Bieri T, Ozersky P and Wilson RK <25 more author(s)>
    Ref: Nat Genet, 36:1268, 2004 : PubMed

            

    Title: Complete genome sequence of Salmonella enterica serovar Typhimurium LT2
    McClelland M, Sanderson KE, Spieth J, Clifton SW, Latreille P, Courtney L, Porwollik S, Ali J, Dante M and Wilson RK <16 more author(s)>
    Ref: Nature, 413:852, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer