Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: salty-YJFP

Salmonella typhi Salmonella typhimurium hypothetical protein yjfp

Comment
There are more than 800 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Family|5_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Salmonella typhi
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Enterobacteriaceae: N E > Salmonella: N E > Salmonella enterica: N E > Salmonella enterica subsp. enterica: N E > Salmonella enterica subsp. enterica serovar Typhi: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AL627283, AE016849, AE008905
2 UniProt : Q8Z173, Q8ZK91
2 Interpro : Q8Z173, Q8ZK91
2 Prodom : Q8Z173, Q8ZK91
2 Pfam : Q8Z173, Q8ZK91
2 PIRSF : Q8Z173, Q8ZK91
2 SUPERFAM : Q8Z173, Q8ZK91
Sequence
Graphical view for this peptide sequence: salty-YJFP
Colored MSA for 5_AlphaBeta_hydrolase (raw)
MIAIETRQLAGGVVLHAFPEGKRAVPLPCVVFYHGFTSSSLVYSYFAVAL
AQAGFRVVMPDAPEHGARFGGDSQGRIHRFWQILHQNMQEFTTLRAAIQA
ENWLLDGRLAVGGASMGGMTALGIMTRHREVKCGASLMGSGYFTGLARTL
FPPLSPQNPAQQAEFDNIIAPLREWEVTHQLERLADRPLLLWHGQEDDVV
PAIETFRLQQALAGAKLDKHVTCLWAAGVRHRITPEALSATVAFFRQHL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MIAIETRQLAGGVVLHAFPEGKRAVPLPCVVFYHGFTSSSLVYSYFAVAL
AQAGFRVVMPDAPEHGARFGGDSQGRIHRFWQILHQNMQEFTTLRAAIQA
ENWLLDGRLAVGGASMGGMTALGIMTRHREVKCGASLMGSGYFTGLARTL
FPPLSPQNPAQQAEFDNIIAPLREWEVTHQLERLADRPLLLWHGQEDDVV
PAIETFRLQQALAGAKLDKHVTCLWAAGVRHRITPEALSATVAFFRQHL


References
    Title: Comparative genomics of Salmonella enterica serovar Typhi strains Ty2 and CT18
    Deng W, Liou SR, Plunkett G, 3rd, Mayhew GF, Rose DJ, Burland V, Kodoyianni V, Schwartz DC, Blattner FR
    Ref: Journal of Bacteriology, 185:2330, 2003 : PubMed

            

    Title: Complete genome sequence of Salmonella enterica serovar Typhimurium LT2
    McClelland M, Sanderson KE, Spieth J, Clifton SW, Latreille P, Courtney L, Porwollik S, Ali J, Dante M and Wilson RK <16 more author(s)>
    Ref: Nature, 413:852, 2001 : PubMed

            

    Title: Complete genome sequence of a multiple drug resistant Salmonella enterica serovar Typhi CT18
    Parkhill J, Dougan G, James KD, Thomson NR, Pickard D, Wain J, Churcher C, Mungall KL, Bentley SD and Barrell BG <31 more author(s)>
    Ref: Nature, 413:848, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer