Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: schcm-d8pxe9

Schizophyllum commune (strain H4-8 / FGSC 9210) (Split gill fungus) Putative uncharacterized protein

Relationship
Family|Prolylcarboxypeptidase
Block| X
Position in NCBI Life Tree|Schizophyllum commune
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Basidiomycota: N E > Agaricomycotina: N E > Agaricomycetes: N E > Agaricomycetidae: N E > Agaricales: N E > Schizophyllaceae: N E > Schizophyllum: N E > Schizophyllum commune: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : GL377304
1 UniProt : D8PXE9
1 UniProt : D8PXE9
1 Interpro : D8PXE9
1 Pfam : D8PXE9
1 PIRSF : D8PXE9
1 SUPERFAM : D8PXE9
Sequence
Graphical view for this peptide sequence: schcm-d8pxe9
Colored MSA for Prolylcarboxypeptidase (raw)
MGVPLALLTLAVLSGVTAAHDAGLISALGPQGVHLVKLNAQNARWKALAD
ASNSAQKPFGGASDDPLYQAYDEFPAQWFEQPLDHFNNETGDTFGQRYWV
NKRHYVPGTNAPVIVLDGGETSGEDRLPFLDTGIVEILTRATGGVGVVLE
HRYYGETKPVQNLTTDSLRFLTNEQSAADSANFMANVKFDGIDEDLTAPG
TPWIYYGGSYAGARAAHMRVLYPDLVFGAIASSAVTHADITNWQYMEVIR
RSAPEACARHLENSIQTIDAVLARGGFPSRALKALFGLSGLEHDDDFASV
LSSPLGYWQAKCWDPQFGSTAFEDFCEVLGKAPAGHLGALEYGDEERMVD
VGDGLALDFSVLNYAKYIRENVVSRCTDNTVEECFGSYDDFQYLATDLDQ
TWRLWLFQVCTQWGYFTTAPPDPAHPRILSKLITLAHESKICKQAFPPGK
HFTVPSMPNVTAVNMLGDFDIRAERLAIIDGEVDPWRPDTPHSEDAIERE
DTISEPFKLIPNGVHHYDEYGYLNLADEPPEIQQIHGEMILFVTEWLKEW
NATRT
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGVPLALLTLAVLSGVTAAHDAGLISALGPQGVHLVKLNAQNARWKALAD
ASNSAQKPFGGASDDPLYQAYDEFPAQWFEQPLDHFNNETGDTFGQRYWV
NKRHYVPGTNAPVIVLDGGETSGEDRLPFLDTGIVEILTRATGGVGVVLE
HRYYGETKPVQNLTTDSLRFLTNEQSAADSANFMANVKFDGIDEDLTAPG
TPWIYYGGSYAGARAAHMRVLYPDLVFGAIASSAVTHADITNWQYMEVIR
RSAPEACARHLENSIQTIDAVLARGGFPSRALKALFGLSGLEHDDDFASV
LSSPLGYWQAKCWDPQFGSTAFEDFCEVLGKAPAGHLGALEYGDEERMVD
VGDGLALDFSVLNYAKYIRENVVSRCTDNTVEECFGSYDDFQYLATDLDQ
TWRLWLFQVCTQWGYFTTAPPDPAHPRILSKLITLAHESKICKQAFPPGK
HFTVPSMPNVTAVNMLGDFDIRAERLAIIDGEVDPWRPDTPHSEDAIERE
DTISEPFKLIPNGVHHYDEYGYLNLADEPPEIQQIHGEMILFVTEWLKEW
NATRT


Reference
    Title: Genome sequence of the model mushroom Schizophyllum commune
    Ohm RA, de Jong JF, Lugones LG, Aerts A, Kothe E, Stajich JE, de Vries RP, Record E, Levasseur A and Wosten HA <22 more author(s)>
    Ref: Nat Biotechnol, 28:957, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer