Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: schja-Q86EA4

Schistosoma japonicum (Blood fluke, platyhelminth) clone zzd627 mrna sequence. (fragment)

Relationship
Family|Carboxypeptidase_S10
Block| X
Position in NCBI Life Tree|Schistosoma japonicum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Platyhelminthes: N E > Trematoda: N E > Digenea: N E > Strigeidida: N E > Schistosomatoidea: N E > Schistosomatidae: N E > Schistosoma: N E > Schistosoma japonicum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AY223316, AY812786
2 UniProt : Q5DI38, Q86EA4
2 UniProt : Q5DI38, Q86EA4
2 Interpro : Q5DI38, Q86EA4
2 Pfam : Q5DI38, Q86EA4
2 PIRSF : Q5DI38, Q86EA4
2 SUPERFAM : Q5DI38, Q86EA4
Sequence
Graphical view for this peptide sequence: schja-Q86EA4
Colored MSA for Carboxypeptidase_S10 (raw)
MGSFLAVLFALVGSLSGLVSNGTRSGDEIMYLPGAWPQPSFKQYSGYLHG
STDKVNIHYWLVEASSSPKQAPLVLWLNGGPGCSSMEGLLNENGPYFLEE
GPRLVENPYSWNKFANVLYFESPAGVGFSYSLDSNPLIDDNQTALDNYHA
LLHFLEKFPEYEGRRLFVTGESYAGVYVPTLSLLLVNSSRFDFKAIAVGN
GLTNYRLNDNSLLYFINYHGLIGENSWNDLINKCCKDKCSTSCMFTDNDS
LECQKIISELSDIPLRGLNRYNLYSECVGGVQTTFNHYSHHNHSSMLIPE
LSSILATSKQFIHHDFGNDFRDNIYVKYRRYANSLLRHNMTTRLAIPCVN
DTLIRSYLNSPIVRRFINVKPDLPNEWDICSDTINANYVRIYRDLSEQYV
KLLQSKIFVLLYNGDIDMACNYFGDELFVDNLKLEVLSPRLPWFYIEKDN
TKQIGGYCKIFRLNEASLLYATVRGAGHMVPQDKPAAAFHLISRFVNFET
PF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGSFLAVLFALVGSLSGLVSNGTRSGDEIMYLPGAWPQPSFKQYSGYLHG
STDKVNIHYWLVEASSSPKQAPLVLWLNGGPGCSSMEGLLNENGPYFLEE
GPRLVENPYSWNKFANVLYFESPAGVGFSYSLDSNPLIDDNQTALDNYHA
LLHFLEKFPEYEGRRLFVTGESYAGVYVPTLSLLLVNSSRFDFKAIAVGN
GLTNYRLNDNSLLYFINYHGLIGENSWNDLINKCCKDKCSTSCMFTDNDS
LECQKIISELSDIPLRGLNRYNLYSECVGGVQTTFNHYSHHNHSSMLIPE
LSSILATSKQFIHHDFGNDFRDNIYVKYRRYANSLLRHNMTTRLAIPCVN
DTLIRSYLNSPIVRRFINVKPDLPNEWDICSDTINANYVRIYRDLSEQYV
KLLQSKIFVLLYNGDIDMACNYFGDELFVDNLKLEVLSPRLPWFYIEKDN
TKQIGGYCKIFRLNEASLLYATVRGAGHMVPQDKPAAAFHLISRFVNFET
PF


Reference
    Title: Evolutionary and biomedical implications of a Schistosoma japonicum complementary DNA resource
    Hu W, Yan Q, Shen DK, Liu F, Zhu ZD, Song HD, Xu XR, Wang ZJ, Rong YP and Han ZG <14 more author(s)>
    Ref: Nat Genet, 35:139, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer