Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: schma-ACHE1

Schistosoma mansoni (Blood fluke, platyhelminth); Schistosoma rodhaini acetylcholinesterase SmAChE1 Smache1-smp_154600

Comment
This enzyme is called SmAChE1 in Tedla et al. 2019 and is inhibited by dichlorvos. Other strain: Schistosoma mansoni (Blood fluke, platyhelminth); Schistosoma rodhaini


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Schistosoma mansoni
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Platyhelminthes: N E > Trematoda: N E > Digenea: N E > Strigeidida: N E > Schistosomatoidea: N E > Schistosomatidae: N E > Schistosoma: N E > Schistosoma mansoni: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AF279461, FN357574, FN357467
2 UniProt : Q71SU7, A0A183QEW4
1 Ncbi-nid : 33339658
1 Ncbi-pid : 33339659
2 UniProt : Q71SU7, A0A183QEW4
2 Interpro : Q71SU7, A0A183QEW4
2 Pfam : Q71SU7, A0A183QEW4
2 PIRSF : Q71SU7, A0A183QEW4
2 SUPERFAM : Q71SU7, A0A183QEW4
Sequence
Graphical view for this peptide sequence: schma-ACHE1
Colored MSA for ACHE (raw)
MSYGIVMNMNLCIITSFLLLDPVLSSRLNAFQNVNNVLIPSIENTIINNS
IAADIDLHNDKTTICSSDNPVVHTSVGIYCGLREIVHWPNGPASMVDVYY
GIRYAQSPTGSLRFKKPVEPIPEPKKIFMADKLPPTCPQPKDTMFQNSAA
ARMWVPNTPMSEDCLFLNIWVPIKESNGSHPNSKEKLAVMLWIYGGSFYM
GTSTLSVYDARFLAARQNIIVASMNYRLGSFGFLYMNTEEAPGNMGLWDQ
RLAMKWIKDHIEHFGGDPYRITLFGESAGAVSVSTHVVSPWSHSYYNNAI
MQSGSIFSNWGLATSEVSLNQTQRLAKILGCGYRSSNDQIKCLRSKSITE
ILDAHDTMYDPASYFSVPFPPVLDNNFFPYENSQSFRQLKYLKPSGALMF
GINKNEGSYFLLYAFVSNSKWMKNLTDLPITNRMDYLRCLRQVLDLDDDD
ERPEFTEPLIRYTDFEYQTYQQLPTLESWTERLEEISSDRSFKCPTINMA
TAVTNDYRIPGRRRAHTLPVYFYEFQHRTVSLPMPKWTGTMHGYEIEYVF
GIPFSPQFQASFYRFTDEERQLSDIMMTYWANFARTGDPNILPDGRHVTD
NLNPDDPDEITEDQLKDSLSHKQGSKNPFIGWPEFRNSTKAYIVFRSAPA
NLLVSTRPRHRQCLFWRRWYPALLQQVERNRQHCLGV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSYGIVMNMNLCIITSFLLLDPVLSSRLNAFQNVNNVLIPSIENTIINNS
IAADIDLHNDKTTICSSDNPVVHTSVGIYCGLREIVHWPNGPASMVDVYY
GIRYAQSPTGSLRFKKPVEPIPEPKKIFMADKLPPTCPQPKDTMFQNSAA
ARMWVPNTPMSEDCLFLNIWVPIKESNGSHPNSKEKLAVMLWIYGGSFYM
GTSTLSVYDARFLAARQNIIVASMNYRLGSFGFLYMNTEEAPGNMGLWDQ
RLAMKWIKDHIEHFGGDPYRITLFGESAGAVSVSTHVVSPWSHSYYNNAI
MQSGSIFSNWGLATSEVSLNQTQRLAKILGCGYRSSNDQIKCLRSKSITE
ILDAHDTMYDPASYFSVPFPPVLDNNFFPYENSQSFRQLKYLKPSGALMF
GINKNEGSYFLLYAFVSNSKWMKNLTDLPITNRMDYLRCLRQVLDLDDDD
ERPEFTEPLIRYTDFEYQTYQQLPTLESWTERLEEISSDRSFKCPTINMA
TAVTNDYRIPGRRRAHTLPVYFYEFQHRTVSLPMPKWTGTMHGYEIEYVF
GIPFSPQFQASFYRFTDEERQLSDIMMTYWANFARTGDPNILPDGRHVTD
NLNPDDPDEITEDQLKDSLSHKQGSKNPFIGWPEFRNSTKAYIVFRSAPA
NLLVSTRPRHRQCLFWRRWYPALLQQVERNRQHCLGV


References
2 more
    Title: Novel cholinesterase paralogs of Schistosoma mansoni have perceived roles in cholinergic signaling and drug detoxification and are essential for parasite survival
    Tedla BA, Sotillo J, Pickering D, Eichenberger RM, Ryan S, Becker L, Loukas A, Pearson MS
    Ref: PLoS Pathog, 15:e1008213, 2019 : PubMed

            

    Title: The genome of the blood fluke Schistosoma mansoni
    Berriman M, Haas BJ, LoVerde PT, Wilson RA, Dillon GP, Cerqueira GC, Mashiyama ST, Al-Lazikani B, Andrade LF and El-Sayed NM <46 more author(s)>
    Ref: Nature, 460:352, 2009 : PubMed

            

    Title: Mapping and sequencing of acetylcholinesterase genes from the platyhelminth blood fluke Schistosoma
    Bentley GN, Jones AK, Agnew A
    Ref: Gene, 314:103, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer