Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: schma-SmLPLH

Schistosoma mansoni (Blood fluke, platyhelminth) lysophospholipase homolog (SmLPLH) mRNA, complete cds

Relationship
Family|LYsophospholipase_carboxylesterase
Block| X
Position in NCBI Life Tree|Schistosoma mansoni
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Platyhelminthes: N E > Trematoda: N E > Digenea: N E > Strigeidida: N E > Schistosomatoidea: N E > Schistosomatidae: N E > Schistosoma: N E > Schistosoma mansoni: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AF006678
1 UniProt : O18501
1 Ncbi-nid : 2246651
1 Ncbi-pid : 2246652
1 UniProt : O18501
1 Interpro : O18501
1 Pfam : O18501
1 PIRSF : O18501
1 SUPERFAM : O18501
Sequence
Graphical view for this peptide sequence: schma-SmLPLH
Colored MSA for LYsophospholipase_carboxylesterase (raw)
MGSSISCISEIDMANKLLPAAVVASRSKHSATLIFLHGLGDTGHGWSDAL
KEYVPDYFKIICPHANSIPVTLNGGMCMPAWYDIYALSENAKQDEAGIKE
ASLELGKFVDAEIKAGVPIGNIVIGGFSQGGSVALYNALTSTLQYGGVVA
FSCWLPLHTKFMSSPTLLTMPKDVPVFQCHGLEDYTIPFAMGKLTHELLK
TFQLSKCELNCYPQLSHSSCEKEMGDLRTFLSKNIPGTQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGSSISCISEIDMANKLLPAAVVASRSKHSATLIFLHGLGDTGHGWSDAL
KEYVPDYFKIICPHANSIPVTLNGGMCMPAWYDIYALSENAKQDEAGIKE
ASLELGKFVDAEIKAGVPIGNIVIGGFSQGGSVALYNALTSTLQYGGVVA
FSCWLPLHTKFMSSPTLLTMPKDVPVFQCHGLEDYTIPFAMGKLTHELLK
TFQLSKCELNCYPQLSHSSCEKEMGDLRTFLSKNIPGTQ


Reference
    Title: Cloning and sequence analysis of a lysophospholipase homologue from Schistosoma mansoni
    Hamdan FF, Ribeiro P
    Ref: Parasitol Res, 84:839, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer