Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: schpo-clr3

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). Cryptic loci regulator 3

Relationship
Family|Arb2_domain
Block| X
Position in NCBI Life Tree|Schizosaccharomyces pombe
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > Taphrinomycotina: N E > Schizosaccharomycetes: N E > Schizosaccharomycetales: N E > Schizosaccharomycetaceae: N E > Schizosaccharomyces: N E > Schizosaccharomyces pombe: N E


Molecular evidence
Database
No mutation
1 structure:
5IKK: Structure of the histone deacetylase Clr3 (only the c-term Arb2 domain is related to alpha/beta hydrolases)
No kinetic





No Substrate
No inhibitor
3 Genbank : AF064207, CU329671, NP_595104.1
1 UniProt : P56523
1 Structure : 5IKK
1 UniProt : P56523
1 Interpro : P56523
1 Prodom : P56523
1 Pfam : P56523
1 PIRSF : P56523
1 SUPERFAM : P56523
Sequence
Graphical view for this peptide sequence: schpo-clr3
Colored MSA for Arb2_domain (raw)
RLHDVIRTYQAKKLFEDWKITNMPILRDSVSNVFNNQVLCSSNFFQKDNL
LVIVHESPRVLGNGTSETNVLNLNDSLLVDPVSLYVEWAMQQDWGLIDIN
IPEVVTDGENAPVDILSEVKELCLYVWDNYVELSISKNIFFIGGGKAVHG
LVNLASSRNVSDRVKCMVNFLGTEPLVGLKTASEEDLPTWYYRHSLVFVS
SSNECWKKAKRAKRRYGRLMQSEHTETSDMMEQHYRAVTQYLLHLLQKAR
PTSQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

RLHDVIRTYQAKKLFEDWKITNMPILRDSVSNVFNNQVLCSSNFFQKDNL
LVIVHESPRVLGNGTSETNVLNLNDSLLVDPVSLYVEWAMQQDWGLIDIN
IPEVVTDGENAPVDILSEVKELCLYVWDNYVELSISKNIFFIGGGKAVHG
LVNLASSRNVSDRVKCMVNFLGTEPLVGLKTASEEDLPTWYYRHSLVFVS
SSNECWKKAKRAKRRYGRLMQSEHTETSDMMEQHYRAVTQYLLHLLQKAR
PTSQ


References
2 more
    Title: SHREC Silences Heterochromatin via Distinct Remodeling and Deacetylation Modules
    Job G, Brugger C, Xu T, Lowe BR, Pfister Y, Qu C, Shanker S, Banos Sanz JI, Partridge JF, Schalch T
    Ref: Mol Cell, 62:207, 2016 : PubMed

            

    Title: The genome sequence of Schizosaccharomyces pombe
    Wood V, Gwilliam R, Rajandream MA, Lyne M, Lyne R, Stewart A, Sgouros J, Peat N, Hayles J and Nurse P <124 more author(s)>
    Ref: Nature, 415:871, 2002 : PubMed

            

    Title: Histone deacetylase homologs regulate epigenetic inheritance of transcriptional silencing and chromosome segregation in fission yeast
    Grewal SI, Bonaduce MJ, Klar AJ
    Ref: Genetics, 150:563, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer