Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: schpo-este1

Schizosaccharomyces pombe chromosome I cosmid c1039,gene SPAC1039.03

Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|Schizosaccharomyces pombe
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > Taphrinomycotina: N E > Schizosaccharomycetes: N E > Schizosaccharomycetales: N E > Schizosaccharomycetaceae: N E > Schizosaccharomyces: N E > Schizosaccharomyces pombe: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AL133521, NC_003424
1 Ncbi-nid : 6594259
1 Ncbi-pid : 6594262
1 UniProt : Q9US38
1 Interpro : Q9US38
1 Prodom : Q9US38
1 Pfam : Q9US38
1 PIRSF : Q9US38
1 SUPERFAM : Q9US38
Sequence
Graphical view for this peptide sequence: schpo-este1
Colored MSA for Hormone-sensitive_lipase_like (raw)
MSQTTTETIIPLDSSVKDKLDPEYVNFYNKYVCSNLPIVKTHTYPVDFLR
NNGNVMPGQSELLPVESTEDITIPRKHTKAPSGVPSRIFRPHGTAPEGGW
PCFLWFHGGGWVLGNINTENSFATHMCEQAKCVVVNVDYRLAPEDPFPAC
IDDGWEALLYCYENADTLGINPNKIAVGGSSAGGNIAAVLSHKVAASPAN
FPPLVLQLLVVPVCDNTANAKTHKSWELFENTPQLPAAKMMWYRRHYLPN
EKDWSNPEASPFFYPDSSFKNVCPALICAAGCDVLSSEAIAYNEKLTKAG
VESTIKIYEGCPHPVMAMDAVLEKGRILNKDATNALLAAFA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSQTTTETIIPLDSSVKDKLDPEYVNFYNKYVCSNLPIVKTHTYPVDFLR
NNGNVMPGQSELLPVESTEDITIPRKHTKAPSGVPSRIFRPHGTAPEGGW
PCFLWFHGGGWVLGNINTENSFATHMCEQAKCVVVNVDYRLAPEDPFPAC
IDDGWEALLYCYENADTLGINPNKIAVGGSSAGGNIAAVLSHKVAASPAN
FPPLVLQLLVVPVCDNTANAKTHKSWELFENTPQLPAAKMMWYRRHYLPN
EKDWSNPEASPFFYPDSSFKNVCPALICAAGCDVLSSEAIAYNEKLTKAG
VESTIKIYEGCPHPVMAMDAVLEKGRILNKDATNALLAAFA


Reference
    Title: The genome sequence of Schizosaccharomyces pombe
    Wood V, Gwilliam R, Rajandream MA, Lyne M, Lyne R, Stewart A, Sgouros J, Peat N, Hayles J and Nurse P <124 more author(s)>
    Ref: Nature, 415:871, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer