Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: scyto-a0a401q2n8

Scyliorhinus torazame (Cloudy catshark). Uncharacterized protein

Relationship
Family|abh_upf0017
Block| X
Position in NCBI Life Tree|Scyliorhinus torazame
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Chondrichthyes: N E > Elasmobranchii: N E > Selachii: N E > Galeomorphii: N E > Galeoidea: N E > Carcharhiniformes: N E > Scyliorhinidae: N E > Scyliorhinus: N E > Scyliorhinus torazame: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : BFAA01009409
1 UniProt : A0A401Q2N8
1 UniProt : A0A401Q2N8
1 Interpro : A0A401Q2N8
1 Prodom : A0A401Q2N8
1 Pfam : A0A401Q2N8
1 PIRSF : A0A401Q2N8
1 SUPERFAM : A0A401Q2N8
Sequence
Graphical view for this peptide sequence: scyto-a0a401q2n8
Colored MSA for abh_upf0017 (raw)
MRPCSRKEGTSLTGSLLAFWIRFPVVVTASAVSWHFAMPLWGPSVCIVSL
AVLYLVARLYFGQSLKDRFHWRSRCARNQGGGDVPKLVCKPSALAKYLLK
TCLTFTSEWQTQWIWRKLPHLQTVWNVIWPPGAAVHFVRDYLQLADEGLV
ALDWAVPSTSSRRRASSNSPAPIILVIPNSFGKITRNLVKLCASALDNGH
RPVIFNRRCQNGSLLTTLKLQQFGDPSDLREAVRYIRYKHPSARLFTVSE
STGAGLLLSYLGECGSSSYVTSAACISPVFRYQEWFETGPPWLYHWFLLF
YQKTWLSRYATVLGEIIDMEKLFATRTLREMEEILFCQTKKSIPCWDLYW
EKNDPLRDVDEVAVPVLCICSQDDPCRGDTDTTLPFELFETNPHFFLLLT
KHGGHCGFLKNRSSVWSHEVLLEYFKSVSEFFMTEERTKSFSKRKYVGAA
NSMSYKCGRGNSFKRDSFCSHNIHDIFNWQRSYTR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRPCSRKEGTSLTGSLLAFWIRFPVVVTASAVSWHFAMPLWGPSVCIVSL
AVLYLVARLYFGQSLKDRFHWRSRCARNQGGGDVPKLVCKPSALAKYLLK
TCLTFTSEWQTQWIWRKLPHLQTVWNVIWPPGAAVHFVRDYLQLADEGLV
ALDWAVPSTSSRRRASSNSPAPIILVIPNSFGKITRNLVKLCASALDNGH
RPVIFNRRCQNGSLLTTLKLQQFGDPSDLREAVRYIRYKHPSARLFTVSE
STGAGLLLSYLGECGSSSYVTSAACISPVFRYQEWFETGPPWLYHWFLLF
YQKTWLSRYATVLGEIIDMEKLFATRTLREMEEILFCQTKKSIPCWDLYW
EKNDPLRDVDEVAVPVLCICSQDDPCRGDTDTTLPFELFETNPHFFLLLT
KHGGHCGFLKNRSSVWSHEVLLEYFKSVSEFFMTEERTKSFSKRKYVGAA
NSMSYKCGRGNSFKRDSFCSHNIHDIFNWQRSYTR


Reference
    Title: Shark genomes provide insights into elasmobranch evolution and the origin of vertebrates
    Hara Y, Yamaguchi K, Onimaru K, Kadota M, Koyanagi M, Keeley SD, Tatsumi K, Tanaka K, Motone F and Kuraku S <14 more author(s)>
    Ref: Nat Ecol Evol, 2:1761, 2018 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer