Gene_locus Report for: shedo-q12ru9Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) Putative uncharacterized protein Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Alteromonadales: N E > Shewanellaceae: N E > Shewanella: N E > Shewanella denitrificans: N E
6_AlphaBeta_hydrolase : shedo-q12nr8Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) alpha/beta hydrolase fold, shedo-q12qc1Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) Male sterility-like protein. A85-EsteraseD-FGH : shedo-q12hn7Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) Carboxylesterase. A85-IroE-IroD-Fes-Yiel : shedo-q12ht4Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) Putative esterase, shedo-q12mf6Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) Putative esterase, shedo-q12mf9Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) Putative esterase, shedo-q12ql5Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) Putative esterase, shedo-q12rc5Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) Putative esterase, shedo-q12sn8Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) Putative esterase. abh_upf0017 : shedo-q12jb4Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) Alpha/beta hydrolase fold. BioH : shedo-q12ic1Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) bioh protein. Chlorophyllase : shedo-q12q68Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013). Uncharacterized protein. DPP4N_Peptidase_S9 : shedo-q12ja5Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) Peptidase S9, prolyl oligopeptidase active site region, shedo-q12jw3Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) Dipeptidyl-peptidase IV. Serine peptidase. MEROPS family S09B. Epoxide_hydrolase : shedo-q12n80Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) alpha/beta hydrolase fold. NLS3-Tex30 : shedo-q12l33Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) Uncharacterized protein. Thioesterase : shedo-q12hs0Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) Amino acid adenylation. UCP031982 : shedo-q12p99Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) Putative uncharacterized protein
Molecular evidence | | Database | No mutation
No structure
No kinetic
No Substrate
No inhibitor
| |
|
Sequence Graphical view for this peptide sequence: shedo-q12ru9
Colored MSA for Duf_3530 (raw)
MLTRRDLILVILFSAAINLLHSPSVYGKTDYDYLPQDEVTSIEVEGQPLP
VLVRPWEGKLRLGSVIIIGPSDSNADAAGFISHLRKSLNPEGWASISLTP
PKGLYRPSFATGAEEIAKAGSEQLSVSGYQPTPLYNSAQLLELRNFQQEA
LTKSFTPLEALSDSYTGLKMYLVSDDSAGILVSLLFDKKIPAPDVLVLIN
PYREHEELIDEPSRRKSIAQQLLMQTFPVLDLQSPNGHPVSLANAHQRQA
VNQLKSPRLYRQYRLNLRLDNPSGWEEAQNYIEGFARIATGN
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MLTRRDLILVILFSAAINLLHSPSVYGKTDYDYLPQDEVTSIEVEGQPLP
VLVRPWEGKLRLGSVIIIGPSDSNADAAGFISHLRKSLNPEGWASISLTP
PKGLYRPSFATGAEEIAKAGSEQLSVSGYQPTPLYNSAQLLELRNFQQEA
LTKSFTPLEALSDSYTGLKMYLVSDDSAGILVSLLFDKKIPAPDVLVLIN
PYREHEELIDEPSRRKSIAQQLLMQTFPVLDLQSPNGHPVSLANAHQRQA
VNQLKSPRLYRQYRLNLRLDNPSGWEEAQNYIEGFARIATGN
|
|
|
|
