Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: shepc-a4yan2

Shewanella putrefaciens; Shewanella sp. Putative uncharacterized protein

Comment
Other strains: Shewanella putrefaciens (CN-32 / ATCC BAA-453;200); Shewanella sp. (W3-18-1)


Relationship
Family|Duf_3530
Block| X
Position in NCBI Life Tree|Shewanella putrefaciens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Alteromonadales: N E > Shewanellaceae: N E > Shewanella: N E > Shewanella putrefaciens: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : CP000681, CP002457, CP000503
2 UniProt : A4YAN2, E6XP18
2 UniProt : A4YAN2, E6XP18
2 Interpro : A4YAN2, E6XP18
2 Pfam : A4YAN2, E6XP18
2 PIRSF : A4YAN2, E6XP18
2 SUPERFAM : A4YAN2, E6XP18
Sequence
Graphical view for this peptide sequence: shepc-a4yan2
Colored MSA for Duf_3530 (raw)
MAHIFLAFWVLSLSLMTLPCLSAEPNTSTETPRANPTRNYLPANEVKQIT
IDNKPYELLVRPWEGKKKLGATIILPATNGTADSPGLMAFLRRNINPAGW
ASLSLTPPKELPAPNFATAAAEVTTAGAAQLATPSNKPSQKIKPEDSNKH
LQEQEEFLIKTMSQLDGIGTDYPGKRVLITAEQSAGILISLLSQKKIADP
DVLIVINPYNEDETRNQAIAEKLAKLTMPILDIQSPDGHPASLETAEQRK
ILAVTLGTPNYRQTTLVLNLDNESAWQNCLNTIKGFAARMSGAH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAHIFLAFWVLSLSLMTLPCLSAEPNTSTETPRANPTRNYLPANEVKQIT
IDNKPYELLVRPWEGKKKLGATIILPATNGTADSPGLMAFLRRNINPAGW
ASLSLTPPKELPAPNFATAAAEVTTAGAAQLATPSNKPSQKIKPEDSNKH
LQEQEEFLIKTMSQLDGIGTDYPGKRVLITAEQSAGILISLLSQKKIADP
DVLIVINPYNEDETRNQAIAEKLAKLTMPILDIQSPDGHPASLETAEQRK
ILAVTLGTPNYRQTTLVLNLDNESAWQNCLNTIKGFAARMSGAH



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer