Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: shepw-b8ci75

Shewanella piezotolerans (strain WP3 / JCM 13877) Putative uncharacterized protein

Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Shewanella piezotolerans
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Alteromonadales: N E > Shewanellaceae: N E > Shewanella: N E > Shewanella piezotolerans: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP000472
1 UniProt : B8CI75
1 UniProt : B8CI75
1 Interpro : B8CI75
1 Prodom : B8CI75
1 Pfam : B8CI75
1 PIRSF : B8CI75
1 SUPERFAM : B8CI75
Sequence
Graphical view for this peptide sequence: shepw-b8ci75
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MLEQVYVEYQVNIESEHQVESFVLVLLQQVDAETIDGYEVVIGNKQITVT
TDALSKYLFTFNDVNHDLRFQVGEAFSITELTGKSNNPKRTITLSKTEGA
PPTALIDRPLVNLVDVKISPAKIGEKAQLTEEKFDRETANLGMWKPVTHL
LEGNSGVFFLDEFDSNKTPILFIHGMSGTARDFTPLLANIDRRNYQVWVM
NYPSGLPLELLANGLNSLIKIIDYRYNVKTLHLVAHSMGGLVAQAYLDLC
RNQLGCNDIASFTSISSPFGGVSSAQSGIDYAPVVMPAWRDLAPSSDFVA
KLFSSSELHSTTPPHLLIFGYKMSGFLNQESSDGVISLASQLNDKAQQRA
VKVYGLNEDHVSILSNDQLIRTLKSFWQESEKAHAER
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLEQVYVEYQVNIESEHQVESFVLVLLQQVDAETIDGYEVVIGNKQITVT
TDALSKYLFTFNDVNHDLRFQVGEAFSITELTGKSNNPKRTITLSKTEGA
PPTALIDRPLVNLVDVKISPAKIGEKAQLTEEKFDRETANLGMWKPVTHL
LEGNSGVFFLDEFDSNKTPILFIHGMSGTARDFTPLLANIDRRNYQVWVM
NYPSGLPLELLANGLNSLIKIIDYRYNVKTLHLVAHSMGGLVAQAYLDLC
RNQLGCNDIASFTSISSPFGGVSSAQSGIDYAPVVMPAWRDLAPSSDFVA
KLFSSSELHSTTPPHLLIFGYKMSGFLNQESSDGVISLASQLNDKAQQRA
VKVYGLNEDHVSILSNDQLIRTLKSFWQESEKAHAER


Reference
    Title: Environmental adaptation: genomic analysis of the piezotolerant and psychrotolerant deep-sea iron reducing bacterium Shewanella piezotolerans WP3
    Wang F, Wang J, Jian H, Zhang B, Li S, Zeng X, Gao L, Bartlett DH, Yu J and Xiao X <1 more author(s)>
    Ref: PLoS ONE, 3:e1937, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer