Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: shevd-d4zhf5

Shewanella violacea (strain JCM 10179 / CIP 106290 / LMG 19151 / DSS12) Prolyl oligopeptidase family protein

Relationship
Family|DPP4N_Peptidase_S9
Block| X
Position in NCBI Life Tree|Shewanella violacea
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Alteromonadales: N E > Shewanellaceae: N E > Shewanella: N E > Shewanella violacea: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AP011177
1 UniProt : D4ZHF5
1 UniProt : D4ZHF5
1 Interpro : D4ZHF5
1 Pfam : D4ZHF5
1 PIRSF : D4ZHF5
1 SUPERFAM : D4ZHF5
Sequence
Graphical view for this peptide sequence: shevd-d4zhf5
Colored MSA for DPP4N_Peptidase_S9 (raw)
MAIWFEEKEEQSDKKEQGDPAAADSGEEVKVDKFDKGSPFELVVLKNGTT
QKVAHVTDYYFDRSGKHLVVASNNSEAKVHQLILFKLSHNTRELVRQYND
QQIGHVSLSDDGKYIGFTHGAADVAPYGRPYNLSLFNIQTSEVKATPTSK
LWKLNRYTQLRFSEDSQRLFFGRVPQVSQQLALAKIDKQEDLFDESIVTG
QRKLRIWHGDDARIKPNEVKEYDKEQKRTYLAVLHLNSNNLVQLADETVP
DVELEEQTRFVLASSDIPYRKMITWAGFYRDYYLIDLNTGRKTLVLTQQP
SGEDPILSPNQRYVTYFQQGNVYLYQISADRRTNLTKDLKVSFADEDHDY
PSNAPGYGFGPWLKGDAGFLVYDKYDIWQVNTQSREAFKLTAGKGRKQGI
QYRVTGLIDDKNHPNVLAIDQQVLLHGYNDRTKGDGYYVSTIGVAGVKTL
MEGDYKLKTLARSKNAETMVFSKERYDLFPDLYTSEHLTPQKANKQTDLD
VQKRQFNWSKSELVHWTNGDGQPLDGVLIKPTDYVEGQRYPVLVYFYRFM
SDRLHAFPQMKINHRPNFAWYADNGYAIFLPDIRFEVGYPGATSVQALTS
GVQKIIEMGIGDPDAIGIQGHSWGGYQAAFAVTQTHIFKAAVSGAPVSNM
TSAYSGIRLGSGLARQFQYETGQSRIGESLFRAPQKYIENSPVFYAERIE
TPMMIMFGDRDDAVPWEQGIELYLAMRRAGKDVVFLQYEDEPHHLKKYPN
KLDYSMRMMEYFDHYLKGKPAPSWLTQGEAYTEYKQAD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAIWFEEKEEQSDKKEQGDPAAADSGEEVKVDKFDKGSPFELVVLKNGTT
QKVAHVTDYYFDRSGKHLVVASNNSEAKVHQLILFKLSHNTRELVRQYND
QQIGHVSLSDDGKYIGFTHGAADVAPYGRPYNLSLFNIQTSEVKATPTSK
LWKLNRYTQLRFSEDSQRLFFGRVPQVSQQLALAKIDKQEDLFDESIVTG
QRKLRIWHGDDARIKPNEVKEYDKEQKRTYLAVLHLNSNNLVQLADETVP
DVELEEQTRFVLASSDIPYRKMITWAGFYRDYYLIDLNTGRKTLVLTQQP
SGEDPILSPNQRYVTYFQQGNVYLYQISADRRTNLTKDLKVSFADEDHDY
PSNAPGYGFGPWLKGDAGFLVYDKYDIWQVNTQSREAFKLTAGKGRKQGI
QYRVTGLIDDKNHPNVLAIDQQVLLHGYNDRTKGDGYYVSTIGVAGVKTL
MEGDYKLKTLARSKNAETMVFSKERYDLFPDLYTSEHLTPQKANKQTDLD
VQKRQFNWSKSELVHWTNGDGQPLDGVLIKPTDYVEGQRYPVLVYFYRFM
SDRLHAFPQMKINHRPNFAWYADNGYAIFLPDIRFEVGYPGATSVQALTS
GVQKIIEMGIGDPDAIGIQGHSWGGYQAAFAVTQTHIFKAAVSGAPVSNM
TSAYSGIRLGSGLARQFQYETGQSRIGESLFRAPQKYIENSPVFYAERIE
TPMMIMFGDRDDAVPWEQGIELYLAMRRAGKDVVFLQYEDEPHHLKKYPN
KLDYSMRMMEYFDHYLKGKPAPSWLTQGEAYTEYKQAD


Reference
    Title: Complete genome sequence and comparative analysis of Shewanella violacea, a psychrophilic and piezophilic bacterium from deep sea floor sediments
    Aono E, Baba T, Ara T, Nishi T, Nakamichi T, Inamoto E, Toyonaga H, Hasegawa M, Takai Y and Mori H <6 more author(s)>
    Ref: Mol Biosyst, 6:1216, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer