shidy-q67dv1

 
Shigella dysenteriae (and serotype 1 (strain Sd197)) Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188 Enterobacter cancerogenus ATCC 35316 IroE protein IroE

Relationship
Block X
Shigella dysenteriae position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Enterobacteriaceae: N E > Shigella: N E > Shigella dysenteriae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 1 more: AY365116, CP000034, CP001122
3 UniProt : Q67DV1, Q32HL7, D2ZH71
3 UniProtTrembl : Q67DV1, Q32HL7, D2ZH71
3 Interpro : Q67DV1, Q32HL7, D2ZH71
3 Prodom : Q67DV1, Q32HL7, D2ZH71
3 Pfam : Q67DV1, Q32HL7, D2ZH71
3 PIRSF : Q67DV1, Q32HL7, D2ZH71
3 SUPERFAM : Q67DV1, Q32HL7, D2ZH71
3 QuickSwissBlast : Q67DV1, Q32HL7, D2ZH71
 
Sequence
Graphical view for this peptide sequence: shidy-q67dv1
Colored MSA for A85-IroE-IroD-Fes-Yiel (raw)
MYAREYRSTRPHKAIFFHLSCLTLICSAQVYAKPDMRPLGPNIADKGSVF
YHFSVTSFDSVDGTRHYRVWTAVPNTTAPASGYPILYMLDGNAVMDRLDD
ELLKQLSEKTPPVIVAVGYQTNFPFDLNSRAYDYTPAAESRKTDLHSGRF
SRKSGGSNNFRQLLETRIAPKVEQGLNIDRQRRGLWGHSYGGLFVLDSWL
SSSYFRSYYSASPSLGRGYDALLSRVTAVEPLQFCAKHLAIMEGSATQGD
NRETHAVGVLSKIHTTLTILKDKGVNVVFWDFPNLGHGPMFNASFRQALL
DISGENANYTAGCHELSH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MYAREYRSTRPHKAIFFHLSCLTLICSAQVYAKPDMRPLGPNIADKGSVF
YHFSVTSFDSVDGTRHYRVWTAVPNTTAPASGYPILYMLDGNAVMDRLDD
ELLKQLSEKTPPVIVAVGYQTNFPFDLNSRAYDYTPAAESRKTDLHSGRF
SRKSGGSNNFRQLLETRIAPKVEQGLNIDRQRRGLWGHSYGGLFVLDSWL
SSSYFRSYYSASPSLGRGYDALLSRVTAVEPLQFCAKHLAIMEGSATQGD
NRETHAVGVLSKIHTTLTILKDKGVNVVFWDFPNLGHGPMFNASFRQALL
DISGENANYTAGCHELSH

no DNA




References
    Title: Antimicrobial resistance-conferring plasmids with similarity to virulence plasmids from avian pathogenic Escherichia coli strains in Salmonella enterica serovar Kentucky isolates from poultry
    Fricke WF, McDermott PF, Mammel MK, Zhao S, Johnson TJ, Rasko DA, Fedorka-Cray PJ, Pedroso A, Whichard JM and Ravel J <3 more author(s)>
    Ref: Applied Environmental Microbiology, 75:5963, 2009 : PubMed

            

    Title: Genome dynamics and diversity of Shigella species, the etiologic agents of bacillary dysentery
    Yang F, Yang J, Zhang X, Chen L, Jiang Y, Yan Y, Tang X, Wang J, Xiong Z and Jin Q <17 more author(s)>
    Ref: Nucleic Acids Research, 33:6445, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer