Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: shifl-BIOH

Shigella flexneri, Shigella sonnei, Shigella boydii, Shigella dysenteriae, Shigella boydii, biotin biosynthesis, reaction prior to pimeloyl coa

Comment
Other strains: Shigella flexneri (serotype 5b (strain 8401)serotype X (strain 2002017); CDC 796-83) Shigella sonnei (strains Ss046; Ss046; 53G) Shigella boydii serotype 4 (strain Sb227) Shigella dysenteriae (serotype 1; Sd197; 1012;CDC 74-1112; 1617) Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)


Relationship
Family|BioH
Block| X
Position in NCBI Life Tree|Shigella flexneri
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Enterobacteriaceae: N E > Shigella: N E > Shigella flexneri: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: shifl-BIOH
Colored MSA for BioH (raw)
MLLHGWGLNAEVWRCIDEELSSHFTLHLVDLPGFGRSRGFGALSLADMAE
AVLQQAPDKAIWLGWSLGGLVASQIALTHPERVQALVTVASSPCFSARDE
WPGIKPDVLAGFQQQLSDDFQRTVERFLALQTMGTETARQDARALKKTVL
ALPMPEVDVLNGGLEILKTVDLRQPLQNVSMPFLRLYGYLDGLVPRKVVP
MLDKLWPHSESYIFAKAAHAPFISHPVEFCHLLVALKQRVLVVSES
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLLHGWGLNAEVWRCIDEELSSHFTLHLVDLPGFGRSRGFGALSLADMAE
AVLQQAPDKAIWLGWSLGGLVASQIALTHPERVQALVTVASSPCFSARDE
WPGIKPDVLAGFQQQLSDDFQRTVERFLALQTMGTETARQDARALKKTVL
ALPMPEVDVLNGGLEILKTVDLRQPLQNVSMPFLRLYGYLDGLVPRKVVP
MLDKLWPHSESYIFAKAAHAPFISHPVEFCHLLVALKQRVLVVSES


References
2 more
    Title: Genome dynamics and diversity of Shigella species, the etiologic agents of bacillary dysentery
    Yang F, Yang J, Zhang X, Chen L, Jiang Y, Yan Y, Tang X, Wang J, Xiong Z and Jin Q <17 more author(s)>
    Ref: Nucleic Acids Research, 33:6445, 2005 : PubMed

            

    Title: Complete genome sequence and comparative genomics of Shigella flexneri serotype 2a strain 2457T
    Wei J, Goldberg MB, Burland V, Venkatesan MM, Deng W, Fournier G, Mayhew GF, Plunkett G, 3rd, Rose DJ and Blattner FR <7 more author(s)>
    Ref: Infect Immun, 71:2775, 2003 : PubMed

            

    Title: Genome sequence of Shigella flexneri 2a: insights into pathogenicity through comparison with genomes of Escherichia coli K12 and O157
    Jin Q, Yuan Z, Xu J, Wang Y, Shen Y, Lu W, Wang J, Liu H, Yang J and Yu J <23 more author(s)>
    Ref: Nucleic Acids Research, 30:4432, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer