Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: shifl-SF1334

Shigella flexneri, Shigella sonnei, Shigella boydii, Shigella dysenteriae, Putative dienelactone hydrolase and related enzymes

Comment
Other strains: Shigella flexneri Shigella sonnei (strain Ss046) Shigella boydii serotype 4 (strain Sb227) Shigella dysenteriae 1012 identical to ecoli-Z2445


Relationship
Family|YcjY-like
Block| X
Position in NCBI Life Tree|Shigella flexneri
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Enterobacteriaceae: N E > Shigella: N E > Shigella flexneri: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: AAMJ02000020, CP000038, AE015159
>3 UniProt links 2 more: B3X367, Q3Z176, Q3Z174
>3 UniProt links 2 more: B3X367, Q3Z176, Q83LA9
>3 Interpro links 2 more: B3X367, Q3Z176, Q83LA9
>3 Prodom links 2 more: B3X367, Q3Z176, Q83LA9
>3 Pfam links 2 more: B3X367, Q3Z176, Q83LA9
>3 PIRSF links 2 more: B3X367, Q3Z176, Q83LA9
>3 SUPERFAM links 2 more: B3X367, Q3Z176, Q83LA9
Sequence
Graphical view for this peptide sequence: shifl-SF1334
Colored MSA for YcjY-like (raw)
MKHIQIRNSDMAWHIAANIQFPPNFDESKQYPAIISVHPFGSCKEQTSGN
IYGKALAEKGYLVLAYDASFQGKSGGEPRWIEDPTQRVEDISRVIDYAVT
LPYVDAERIGVLGVCGGGGYAINAALTEKRIKAVVSITGVNIGRLFREGF
SNYDPIGVLNAMASQRTKEARGGELQINELLPSSLDAAKAHGLTERDVYE
ATDYYKTPRGQQPGGATKMLFSHAQKTLAWDAFAFTEVLLTQPVMVVVGE
KVGAFGAYRDGLEVYGRAMVSQDRQLVSLPDFSHYELYDKPEAVQEALAK
VIPFFNTHLG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKHIQIRNSDMAWHIAANIQFPPNFDESKQYPAIISVHPFGSCKEQTSGN
IYGKALAEKGYLVLAYDASFQGKSGGEPRWIEDPTQRVEDISRVIDYAVT
LPYVDAERIGVLGVCGGGGYAINAALTEKRIKAVVSITGVNIGRLFREGF
SNYDPIGVLNAMASQRTKEARGGELQINELLPSSLDAAKAHGLTERDVYE
ATDYYKTPRGQQPGGATKMLFSHAQKTLAWDAFAFTEVLLTQPVMVVVGE
KVGAFGAYRDGLEVYGRAMVSQDRQLVSLPDFSHYELYDKPEAVQEALAK
VIPFFNTHLG


References
    Title: Genome dynamics and diversity of Shigella species, the etiologic agents of bacillary dysentery
    Yang F, Yang J, Zhang X, Chen L, Jiang Y, Yan Y, Tang X, Wang J, Xiong Z and Jin Q <17 more author(s)>
    Ref: Nucleic Acids Research, 33:6445, 2005 : PubMed

            

    Title: Genome sequence of Shigella flexneri 2a: insights into pathogenicity through comparison with genomes of Escherichia coli K12 and O157
    Jin Q, Yuan Z, Xu J, Wang Y, Shen Y, Lu W, Wang J, Liu H, Yang J and Yu J <23 more author(s)>
    Ref: Nucleic Acids Research, 30:4432, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer