shifl-YBFF

 
Shigella flexneri, Shigella sonnei, Shigella boydii, Shigella dysenteriae, orf, conserved hypothetical protein ybff

Comment
Shigella flexneri (serotype X (strain 2002017)serotype 5b (strain 8401); CDC 796-83; 2a str. 2457T) Shigella sonnei (strain Ss046) Shigella boydii (serotype 4 (strain Sb227)serotype 18 (strain CDC 3083-94 / BS512) ATCC 9905) Shigella dysenteriae serotype 1 (strain Sd197) CDC 74-1112


Relationship
Block X
Shigella flexneri position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Enterobacteriaceae: N E > Shigella: N E > Shigella flexneri: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 10 more: CP000266, CP001383, CP001063
>3 UniProt links 4 more: Q0T6T4, D2A9X0, B2TU45
>3 UniProtTrembl links 5 more: Q83LY7, Q0T6T4, D2A9X0
>3 Interpro links 5 more: Q83LY7, Q0T6T4, D2A9X0
>3 Prodom links 5 more: Q83LY7, Q0T6T4, D2A9X0
>3 Pfam links 5 more: Q83LY7, Q0T6T4, D2A9X0
>3 PIRSF links 5 more: Q83LY7, Q0T6T4, D2A9X0
>3 SUPERFAM links 5 more: Q83LY7, Q0T6T4, D2A9X0
>3 QuickSwissBlast links 5 more: Q83LY7, Q0T6T4, D2A9X0
 
Sequence
Graphical view for this peptide sequence: shifl-YBFF
Colored MSA for ABHD11-Acetyl_transferase (raw)
MKLNIRAQTAQNQHNNSPIVLVHGLFGSLDNLGVLARDLVNDHNIIQVDM
RNHGLSPREPVMNYPAMAQDLVDTLDALQIDKATFIGHSMGGKAVMALTA
LAPDRIDKLVAIDIAPVDYHVRRHDEIFAAINAVSESDAQTRQQAAAIMR
QHLNEEGVIQFLLKSFVDGEWRFNVPVLWDQYPHIVGWEKIPAWDHPALF
IPGGNSPYVSEQYRDDLLAQFPQARAHVIAGAGHWVHAEKPDAVLRAIRR
YLND
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKLNIRAQTAQNQHNNSPIVLVHGLFGSLDNLGVLARDLVNDHNIIQVDM
RNHGLSPREPVMNYPAMAQDLVDTLDALQIDKATFIGHSMGGKAVMALTA
LAPDRIDKLVAIDIAPVDYHVRRHDEIFAAINAVSESDAQTRQQAAAIMR
QHLNEEGVIQFLLKSFVDGEWRFNVPVLWDQYPHIVGWEKIPAWDHPALF
IPGGNSPYVSEQYRDDLLAQFPQARAHVIAGAGHWVHAEKPDAVLRAIRR
YLND

no DNA




References
2 more
    Title: Emergence of a new multidrug-resistant serotype X variant in an epidemic clone of Shigella flexneri
    Ye C, Lan R, Xia S, Zhang J, Sun Q, Zhang S, Jing H, Wang L, Li Z and Xu J <11 more author(s)>
    Ref: J Clin Microbiol, 48:419, 2010 : PubMed

            

    Title: Complete genome sequence of Shigella flexneri 5b and comparison with Shigella flexneri 2a
    Nie H, Yang F, Zhang X, Yang J, Chen L, Wang J, Xiong Z, Peng J, Sun L and Jin Q <6 more author(s)>
    Ref: BMC Genomics, 7:173, 2006 : PubMed

            

    Title: Genome sequence of Shigella flexneri 2a: insights into pathogenicity through comparison with genomes of Escherichia coli K12 and O157
    Jin Q, Yuan Z, Xu J, Wang Y, Shen Y, Lu W, Wang J, Liu H, Yang J and Yu J <23 more author(s)>
    Ref: Nucleic Acids Research, 30:4432, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer