shifl-YCJY

 
Shigella flexneri, Shigella dysenteriae, Shigella sonnei, Shigella boydii, ycjY Dienelactone hydrolase

Comment
Other strains: Shigella flexneri (and serotype 5b (strain 8401)), Shigella dysenteriae 1012 Shigella sonnei (strain Ss046) Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)


Relationship
Family YcjY-like
Block X
Shigella flexneri position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Enterobacteriaceae: N E > Shigella: N E > Shigella flexneri: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 2 more: CP001063, CP000266, AAMJ02000020
>3 UniProt links 1 more: B2U0M3, Q0T570, B3X366
>3 UniProtTrembl links 2 more: B2U0M3, Q0T570, Q83LA7
>3 Interpro links 2 more: B2U0M3, Q0T570, Q83LA7
>3 Prodom links 2 more: B2U0M3, Q0T570, Q83LA7
>3 Pfam links 2 more: B2U0M3, Q0T570, Q83LA7
>3 PIRSF links 2 more: B2U0M3, Q0T570, Q83LA7
>3 SUPERFAM links 2 more: B2U0M3, Q0T570, Q83LA7
>3 QuickSwissBlast links 2 more: B2U0M3, Q0T570, Q83LA7
 
Sequence
Graphical view for this peptide sequence: shifl-YCJY
Colored MSA for YcjY-like (raw)
MMNNKVSFTNSNNPTISLSAVIYFPPKFDETRQYPAIVVSHPGGGVKEQT
AGTYAEKLAEKGFVTIAYDASYQGESGGEPRQLENPYIRTEDVSAVIDYL
TTLSYVDNTRIGAMGICAGAGYTANAAIQDRRIKAIGTVSAVNIGSMFRN
GWENNVKSIDALPHIEAGSNARTSDISSEEYAIMPLAPMKEADAPNEELR
QAWEYYHTPRAQYPTAPGYATLRSLNQIITYDAYHMAEVYLTQPMQIVAG
SQAGSKWMSDDLYDRASSQDKRYHIVEGANHMDLYDGKAYVAEAISVLAP
FFEETL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MMNNKVSFTNSNNPTISLSAVIYFPPKFDETRQYPAIVVSHPGGGVKEQT
AGTYAEKLAEKGFVTIAYDASYQGESGGEPRQLENPYIRTEDVSAVIDYL
TTLSYVDNTRIGAMGICAGAGYTANAAIQDRRIKAIGTVSAVNIGSMFRN
GWENNVKSIDALPHIEAGSNARTSDISSEEYAIMPLAPMKEADAPNEELR
QAWEYYHTPRAQYPTAPGYATLRSLNQIITYDAYHMAEVYLTQPMQIVAG
SQAGSKWMSDDLYDRASSQDKRYHIVEGANHMDLYDGKAYVAEAISVLAP
FFEETL

no DNA




References
    Title: Complete genome sequence of Shigella flexneri 5b and comparison with Shigella flexneri 2a
    Nie H, Yang F, Zhang X, Yang J, Chen L, Wang J, Xiong Z, Peng J, Sun L and Jin Q <6 more author(s)>
    Ref: BMC Genomics, 7:173, 2006 : PubMed

            

    Title: Genome dynamics and diversity of Shigella species, the etiologic agents of bacillary dysentery
    Yang F, Yang J, Zhang X, Chen L, Jiang Y, Yan Y, Tang X, Wang J, Xiong Z and Jin Q <17 more author(s)>
    Ref: Nucleic Acids Research, 33:6445, 2005 : PubMed

            

    Title: Genome sequence of Shigella flexneri 2a: insights into pathogenicity through comparison with genomes of Escherichia coli K12 and O157
    Jin Q, Yuan Z, Xu J, Wang Y, Shen Y, Lu W, Wang J, Liu H, Yang J and Yu J <23 more author(s)>
    Ref: Nucleic Acids Research, 30:4432, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer