Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: shifl-YFBB

Shigella flexneri, Shigella sonnei, Shigella boydii, Shigella dysenteriae, 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase

Comment
Other strains: Shigella flexneri (strains serotype X (strain 2002017); CDC 796-83; 2a str. 2457T; K-218; VA-6; K-272; K-227; K-304; K-671; 2747-71; 4343-70; 2930-71; J1713; 5a str. M90T) Shigella sonnei (strains Ss046; 53G) Shigella boydii (strains serotype4 (strains Sb227; 3594-74; 5216-82); serotype18 (strains CDC3083-94/BS512); ATCC 9905) Shigella dysenteriae (serotype 1 Sd197; serotype 5b 8401; 1012; CDC74-1112; 1617; 155-74) Shigella sp. D9


Relationship
Family|MenH_SHCHC
Block| X
Position in NCBI Life Tree|Shigella flexneri
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Enterobacteriaceae: N E > Shigella: N E > Shigella flexneri: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 28 more: AERO01000020, AERN01000081, AERM01000122
>3 UniProt links 10 more: Q83QT4, E7T2P7, D2AFW9
>3 UniProt links 10 more: Q83QT4, E7T2P7, D2AFW9
>3 Interpro links 10 more: Q83QT4, E7T2P7, D2AFW9
>3 Prodom links 10 more: Q83QT4, E7T2P7, D2AFW9
>3 Pfam links 10 more: Q83QT4, E7T2P7, D2AFW9
>3 PIRSF links 10 more: Q83QT4, E7T2P7, D2AFW9
>3 SUPERFAM links 10 more: Q83QT4, E7T2P7, D2AFW9
Sequence
Graphical view for this peptide sequence: shifl-YFBB
Colored MSA for MenH_SHCHC (raw)
MILHAQAKHGKLGLPWLVFLHGFSGDCHEWQEVGEAFADYSRLYVDLLGH
GGSAAISVDGFDDVTDLLRKTLVSYNILDFWLVGYSLGGRVAMMAACQGL
AGLCGVIVEGGHPGLQNAEQRAERQRSDRQWAQRFRTEPLTAVFADWYQQ
PVFASLNDDQRRELVALRSNNNGATLAAMLEATSLAVQPDLRANLSARTF
AFYYLCGERDSKFRALAAELAADCHVIPRAGHNAHRENPAGVIASLAQIL
RF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MILHAQAKHGKLGLPWLVFLHGFSGDCHEWQEVGEAFADYSRLYVDLLGH
GGSAAISVDGFDDVTDLLRKTLVSYNILDFWLVGYSLGGRVAMMAACQGL
AGLCGVIVEGGHPGLQNAEQRAERQRSDRQWAQRFRTEPLTAVFADWYQQ
PVFASLNDDQRRELVALRSNNNGATLAAMLEATSLAVQPDLRANLSARTF
AFYYLCGERDSKFRALAAELAADCHVIPRAGHNAHRENPAGVIASLAQIL
RF


References
2 more
    Title: Emergence of a new multidrug-resistant serotype X variant in an epidemic clone of Shigella flexneri
    Ye C, Lan R, Xia S, Zhang J, Sun Q, Zhang S, Jing H, Wang L, Li Z and Xu J <11 more author(s)>
    Ref: J Clin Microbiol, 48:419, 2010 : PubMed

            

    Title: Complete genome sequence and comparative genomics of Shigella flexneri serotype 2a strain 2457T
    Wei J, Goldberg MB, Burland V, Venkatesan MM, Deng W, Fournier G, Mayhew GF, Plunkett G, 3rd, Rose DJ and Blattner FR <7 more author(s)>
    Ref: Infect Immun, 71:2775, 2003 : PubMed

            

    Title: Genome sequence of Shigella flexneri 2a: insights into pathogenicity through comparison with genomes of Escherichia coli K12 and O157
    Jin Q, Yuan Z, Xu J, Wang Y, Shen Y, Lu W, Wang J, Liu H, Yang J and Yu J <23 more author(s)>
    Ref: Nucleic Acids Research, 30:4432, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer