shifl-entf

 
Shigella flexneri, Shigella boydii, Shigella dysenteriae, Shigella sonnei, atp-dependent serine activating enzyme. (seryl-amp ligase)

Comment
Other strains: Shigella flexneri (and serotype X (strain 2002017); serotype 5b (strain 8401); 2a str. 2457T; CDC 796-83) Shigella boydii (serotype 4 (strain Sb227)serotype 18 (strain CDC 3083-94 / BS512)) Shigella dysenteriae (serotype 1 (strain Sd197); CDC 74-1112; 1617) Shigella sonnei 53G. Some sequences (including ENTF_SHIFL) lack the active serine (seq errors?) Here QOT735 Shigella flexneri CDC 796-83


Relationship
Block X
Shigella flexneri position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Enterobacteriaceae: N E > Shigella: N E > Shigella flexneri: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 5 more: AE015081, M63304, CP001063
>3 UniProt links 4 more: P29698, B2TTE5, Q0T735
>3 UniProtTrembl links 4 more: P29698, B2TTE5, Q0T735
>3 Interpro links 4 more: P29698, B2TTE5, Q0T735
>3 Prodom links 4 more: P29698, B2TTE5, Q0T735
>3 Pfam links 4 more: P29698, B2TTE5, Q0T735
>3 PIRSF links 4 more: P29698, B2TTE5, Q0T735
>3 SUPERFAM links 4 more: P29698, B2TTE5, Q0T735
>3 QuickSwissBlast links 4 more: P29698, B2TTE5, Q0T735
 
Sequence
Graphical view for this peptide sequence: shifl-entf
Colored MSA for Thioesterase (raw)
PELKAQAPGRAPKAGSETIIAAAFASLLGCDVQDADADFFALGGHSLLAM
KLAAQLSRQFARQVTPGQVMVASTVAKLATIIDGEEDSSRRMGFETILPL
REGNGPTLFCFHPASGFAWQFSVLSRYLDPQWSIIGIQSPRPHGPMQTAT
NLDEVCEAHLATLLEQQPHGPYYLLGYSLGGTLAQGIAARLRARGEQVAF
LGLLDTWPPETQNWQEKEANGLDPEVLAEINREREAFLAAQQGSTSTELF
TTIEGNYADAVRLLTTAHSVPFDGKATLFVAERTLQEGMSPERAWSPWIA
ELDIYRQDCAHVDIISPGAFVKIGPIIRATLNR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

PELKAQAPGRAPKAGSETIIAAAFASLLGCDVQDADADFFALGGHSLLAM
KLAAQLSRQFARQVTPGQVMVASTVAKLATIIDGEEDSSRRMGFETILPL
REGNGPTLFCFHPASGFAWQFSVLSRYLDPQWSIIGIQSPRPHGPMQTAT
NLDEVCEAHLATLLEQQPHGPYYLLGYSLGGTLAQGIAARLRARGEQVAF
LGLLDTWPPETQNWQEKEANGLDPEVLAEINREREAFLAAQQGSTSTELF
TTIEGNYADAVRLLTTAHSVPFDGKATLFVAERTLQEGMSPERAWSPWIA
ELDIYRQDCAHVDIISPGAFVKIGPIIRATLNR

no DNA




References
2 more
    Title: Complete genome sequence of Shigella flexneri 5b and comparison with Shigella flexneri 2a
    Nie H, Yang F, Zhang X, Yang J, Chen L, Wang J, Xiong Z, Peng J, Sun L and Jin Q <6 more author(s)>
    Ref: BMC Genomics, 7:173, 2006 : PubMed

            

    Title: Genome sequence of Shigella flexneri 2a: insights into pathogenicity through comparison with genomes of Escherichia coli K12 and O157
    Jin Q, Yuan Z, Xu J, Wang Y, Shen Y, Lu W, Wang J, Liu H, Yang J and Yu J <23 more author(s)>
    Ref: Nucleic Acids Research, 30:4432, 2002 : PubMed

            

    Title: Genetic analysis of the enterobactin gene cluster in Shigella flexneri.
    Schmitt MP, Payne SM
    Ref: Journal of Bacteriology, 173:816, 1991 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer