shiss-yaim

 
Shigella sonnei S-formylglutathione hydrolase frmB (strain Ss046)Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)

Comment
Q3Z551 Shigella sonnei (strain Ss046) putative esterase (EC 3.1.1.1) Yang et al


Relationship
Block X
Shigella sonnei position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Enterobacteriaceae: N E > Shigella: N E > Shigella sonnei: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



2 Genbank : CP000038, CP001063
2 UniProt : Q3Z551, B2U3V9
2 UniProtTrembl : Q3Z551, B2U3V9
2 Interpro : Q3Z551, B2U3V9
2 Prodom : Q3Z551, B2U3V9
2 Pfam : Q3Z551, B2U3V9
2 PIRSF : Q3Z551, B2U3V9
2 SUPERFAM : Q3Z551, B2U3V9
2 QuickSwissBlast : Q3Z551, B2U3V9
 
Sequence
Graphical view for this peptide sequence: shiss-yaim
Colored MSA for A85-EsteraseD-FGH (raw)
MELIEKHASFGGWQNVYRHYSQSLKCEMNVGVYLPPKAANEKLPVLYWLS
GLTCNEQNFITKSGMQRYAAEHNIIVVAPDTSPRGSHVADADRYDLGQGA
GFYLNATQAPWNEHYKMYDYIRNELPDLVMQHFPATTRKSISGHSMGGLG
ALVLALRNPDEYVSVSAFSPIVSPSQVPWGQQAFAAYLGENKDAWLDYDP
VSLISQGQRVAEIMVDQGLSDDFYAEQLRTPNLEKICQEMNIKTLIRYHE
GYDHSYYFVSSFIGEHIAYHANKLNMR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MELIEKHASFGGWQNVYRHYSQSLKCEMNVGVYLPPKAANEKLPVLYWLS
GLTCNEQNFITKSGMQRYAAEHNIIVVAPDTSPRGSHVADADRYDLGQGA
GFYLNATQAPWNEHYKMYDYIRNELPDLVMQHFPATTRKSISGHSMGGLG
ALVLALRNPDEYVSVSAFSPIVSPSQVPWGQQAFAAYLGENKDAWLDYDP
VSLISQGQRVAEIMVDQGLSDDFYAEQLRTPNLEKICQEMNIKTLIRYHE
GYDHSYYFVSSFIGEHIAYHANKLNMR

no DNA




Reference
    Title: Genome dynamics and diversity of Shigella species, the etiologic agents of bacillary dysentery
    Yang F, Yang J, Zhang X, Chen L, Jiang Y, Yan Y, Tang X, Wang J, Xiong Z and Jin Q <17 more author(s)>
    Ref: Nucleic Acids Research, 33:6445, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer