shiss-yeiG

 
Shigella sonnei, Shigella flexneri, Shigella boydii, Shigella dysenteriae, Anaerococcus tetradius, yeiG B2154 frmC

Comment
Other strains: Shigella sonnei (strains Ss046; 53G), Shigella flexneri (serotype 5b (strain 8401); 2a str. 2457T; CDC 796-83; 1485-80; 5a str. M90T; VA-6; K-671; K-227; CDC 796-83; 4343-70; 2747-71; K-315; 6603-63; K-304; 2930-71; K-272; CCH060; K-1770; K-218; 2850-71; J1713; K-404; 1235-66; 2a str. 2457T) Shigella boydii (serotype 4 (strain Sb227); serotype 18 (strain CDC 3083-94 / BS512); ATCC 9905) Shigella dysenteriae (serotype 1 (strain Sd197; 1012);1617; CDC 74-1112) Anaerococcus tetradius ATCC 35098


Relationship
Block X
Shigella sonnei position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Enterobacteriaceae: N E > Shigella: N E > Shigella sonnei: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 3 more: AAMJ02000002, CP000036, CP000034
>3 UniProt links 5 more: B3WW87, Q3Z052, Q31YW2
>3 UniProtTrembl links 5 more: B3WW87, Q3Z052, Q31YW2
>3 Interpro links 5 more: B3WW87, Q3Z052, Q31YW2
>3 Prodom links 5 more: B3WW87, Q3Z052, Q31YW2
>3 Pfam links 5 more: B3WW87, Q3Z052, Q31YW2
>3 PIRSF links 5 more: B3WW87, Q3Z052, Q31YW2
>3 SUPERFAM links 5 more: B3WW87, Q3Z052, Q31YW2
>3 QuickSwissBlast links 5 more: B3WW87, Q3Z052, Q31YW2
 
Sequence
Graphical view for this peptide sequence: shiss-yeiG
Colored MSA for A85-EsteraseD-FGH (raw)
MEMLEEHRCFEGWQQRWRHDSSTLNCPMTFSIFLPPPRDHTPPPVLYWLS
GLTCNDENFTTKAGAQRVAAELGIVLVMPDTSPRGEKVANDDGYDLGQGA
GFYLNATQPPWATHYRMYDYLRDELPALVQSQFNVSDRCAISGHSMGGHG
ALIMALKNPGKYTSVSAFAPIVNPCSVPWGIKAFSTYLGEDKNAWLEWDS
CALMYASNAQDAIPTLIDQGDNDQFLADQLQPAVLAEAARQKAWPMTLRI
QPGYDHSYYFIASFIEDHLRFHAQYLLK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEMLEEHRCFEGWQQRWRHDSSTLNCPMTFSIFLPPPRDHTPPPVLYWLS
GLTCNDENFTTKAGAQRVAAELGIVLVMPDTSPRGEKVANDDGYDLGQGA
GFYLNATQPPWATHYRMYDYLRDELPALVQSQFNVSDRCAISGHSMGGHG
ALIMALKNPGKYTSVSAFAPIVNPCSVPWGIKAFSTYLGEDKNAWLEWDS
CALMYASNAQDAIPTLIDQGDNDQFLADQLQPAVLAEAARQKAWPMTLRI
QPGYDHSYYFIASFIEDHLRFHAQYLLK

no DNA




References
    Title: Complete genome sequence of Shigella flexneri 5b and comparison with Shigella flexneri 2a
    Nie H, Yang F, Zhang X, Yang J, Chen L, Wang J, Xiong Z, Peng J, Sun L and Jin Q <6 more author(s)>
    Ref: BMC Genomics, 7:173, 2006 : PubMed

            

    Title: Genome dynamics and diversity of Shigella species, the etiologic agents of bacillary dysentery
    Yang F, Yang J, Zhang X, Chen L, Jiang Y, Yan Y, Tang X, Wang J, Xiong Z and Jin Q <17 more author(s)>
    Ref: Nucleic Acids Research, 33:6445, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer