Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: sitav-ACHE1

Sitobion avenae (English grain aphid) acetylcholinesterase 1 mRNA, complete cds

Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Sitobion avenae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Paraneoptera: N E > Hemiptera: N E > Sternorrhyncha: N E > Aphidomorpha: N E > Aphidoidea: N E > Aphididae: N E > Aphidinae: N E > Macrosiphini: N E > Sitobion: N E > Sitobion avenae: N E


Molecular evidence
Database
1 mutation: sitav-ACHE1
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AY819704
1 UniProt : Q5PY82
1 Ncbi-nid : 55977447
1 Ncbi-pid : 55977448
1 UniProt : Q5PY82
1 Interpro : Q5PY82
1 Prodom : Q5PY82
1 Pfam : Q5PY82
1 PIRSF : Q5PY82
1 SUPERFAM : Q5PY82
Sequence
Graphical view for this peptide sequence: sitav-ACHE1
Colored MSA for ACHE (raw)
MDQWLLWFGYLVASTYGLSLRHARHQSVGTPTVEEILEPQILIEDTDHVF
RQRASDMFAQEPEYTEKRNLNHRRRSEFSGNQDNDFESSGETYSAYKSDD
PLVIHTNKGKIRGITQAASSGKLVDAWLGIPYAKKPIGDLRFRHPRPIDR
WDKTSPETILNCTTPPNTCVQIFDTLFGDFPGATMWNPNSPVSEDCLYIN
VVVPKLRPQNAAVVVWIFGGGFYSGSATLDIYDPKVLVSEENVILVSMQY
RVASLGFLYFDTEDVPGNAGLFDQLMALQWVHENIKLFGGNPNNVTLFGE
SAGAVSVSLHLLSPLSRNLFNQAIMESGSSTAPWAILSREESYNRGLKLA
KAMGCPDDRNAIHKTVECLRKVNSSAMVEKEWDHVAICFFPFVPVVDGAF
LDDYPQKSLSTNNFKKTNILMGSNSEEGYYSIFYYLTELFKKEENVVVSR
ENFVKAIGQLNPNADAAVKSAIEFEYTDWFSPNDPEKNRNALDKMVGDYQ
FTCNVNEFAHKYALTGNNVYMYYFKHRSLNNPWPKWTGVMHGDEISYVFG
DPLNPNKRYEIEEIELSKKMMRYWTNFAKTGNPSKTFEGSWVTPKWPVHT
AYGKEFLTLDTNNTSIGVGPRLEQCAFWKNYVPDLTAISKSMKSDKNCTT
ISGGTKTNMIKLSLWTIVMTTAVLVL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDQWLLWFGYLVASTYGLSLRHARHQSVGTPTVEEILEPQILIEDTDHVF
RQRASDMFAQEPEYTEKRNLNHRRRSEFSGNQDNDFESSGETYSAYKSDD
PLVIHTNKGKIRGITQAASSGKLVDAWLGIPYAKKPIGDLRFRHPRPIDR
WDKTSPETILNCTTPPNTCVQIFDTLFGDFPGATMWNPNSPVSEDCLYIN
VVVPKLRPQNAAVVVWIFGGGFYSGSATLDIYDPKVLVSEENVILVSMQY
RVASLGFLYFDTEDVPGNAGLFDQLMALQWVHENIKLFGGNPNNVTLFGE
SAGAVSVSLHLLSPLSRNLFNQAIMESGSSTAPWAILSREESYNRGLKLA
KAMGCPDDRNAIHKTVECLRKVNSSAMVEKEWDHVAICFFPFVPVVDGAF
LDDYPQKSLSTNNFKKTNILMGSNSEEGYYSIFYYLTELFKKEENVVVSR
ENFVKAIGQLNPNADAAVKSAIEFEYTDWFSPNDPEKNRNALDKMVGDYQ
FTCNVNEFAHKYALTGNNVYMYYFKHRSLNNPWPKWTGVMHGDEISYVFG
DPLNPNKRYEIEEIELSKKMMRYWTNFAKTGNPSKTFEGSWVTPKWPVHT
AYGKEFLTLDTNNTSIGVGPRLEQCAFWKNYVPDLTAISKSMKSDKNCTT
ISGGTKTNMIKLSLWTIVMTTAVLVL


References
    Title: Resistance mechanisms and associated mutations in acetylcholinesteras genes in Sitobion avenae (Fabricius)
    Chen M, Han Z, Qiao X, Qu M
    Ref: Pesticide Biochemistry and Physiology, 87:189, 2007 : PubMed

            

    Title: Cloning and sequence analysis of 2 different acetylcholinesterase genes in Rhopalosiphum padi and Sitobion avenae
    Chen M, Han Z
    Ref: Genome, 49:239, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer